psepu-q9wwz4

Pseudomonas putida (Arthrobacter siderocapsulatus); Pseudomonas monteilii ; Pseudomonas sp.; Pseudomonas taiwanensis; Pseudomonas plecoglossicida, PcaD-like protein

Comment

"Other strains: Pseudomonas putida (LS46\; S16\; F1 \/ ATCC 700007\; BIRD-1\; KT2440\; TRO1\; HB3267\; LF54\; GB-1\; S12\; ND6\; H8234\; NBRC 14164\; DOT-T1E\; Pseudomonas monteilii (SB3101\; SB3078)\; Pseudomonas sp. (TJI-51\; WCS358\; FGI182\; H2)\; Pseudomonas taiwanensis SJ9\; Pseudomonas plecoglossicida"

Relationship

Family : Carboxymethylbutenolide_lactonase

Block : X

Position in NCBI Life Tree : Pseudomonas putida

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MAHLQLADGVLNYQIDGPDDAPVLVLSNSLGTDLGMWDTQ
IPLWSQHFRV LRYDTRGHGASLVTEGPYSIEQLGRDVLA
LLDGLDIQKAHFVGLSMGGLI GQWLGIHAGERLHSLTLC
NTAAKIANDEVWNTRIDTVLKGGQQAMVDLRD ASIARWF
TPGFAQAQAEQAQRICQMLAQTSPQGYAGNCAAVRDADYR
EQL GRIQVPALIVAGTEDVVTTPEHGRFMQAGIQGAEYV
DFPAAHLSNVDIGE AFSRRVLDFLLAH

References

Title : Complete Genome Sequences of Pseudomonas monteilii SB3078 and SB3101, Two Benzene-, Toluene-, and Ethylbenzene-Degrading Bacteria Used for Bioaugmentation - Dueholm_2014_Genome.Announc_2_e00524
Author(s) : Dueholm MS , Albertsen M , D'Imperio S , Tale VP , Lewis D , Nielsen PH , Nielsen JL
Ref : Genome Announc , 2 : , 2014
Abstract : Dueholm_2014_Genome.Announc_2_e00524
ESTHER : Dueholm_2014_Genome.Announc_2_e00524
PubMedSearch : Dueholm_2014_Genome.Announc_2_e00524
PubMedID: 24874689
Gene_locus related to this paper: psepu-PP4916 , psepu-q9wwz4

Title : Complete Genome Sequence of the p-Nitrophenol-Degrading Bacterium Pseudomonas putida DLL-E4 - Hu_2014_Genome.Announc_2_e00596
Author(s) : Hu X , Wang J , Wang F , Chen Q , Huang Y , Cui Z
Ref : Genome Announc , 2 : , 2014
Abstract : Hu_2014_Genome.Announc_2_e00596
ESTHER : Hu_2014_Genome.Announc_2_e00596
PubMedSearch : Hu_2014_Genome.Announc_2_e00596
PubMedID: 24948765
Gene_locus related to this paper: psepu-q9wwz4 , psepu-a0a059uyg1

Title : Antibiotic resistance determinants in a Pseudomonas putida strain isolated from a hospital - Molina_2014_PLoS.One_9_e81604
Author(s) : Molina L , Udaondo Z , Duque E , Fernandez M , Molina-Santiago C , Roca A , Porcel M , de la Torre J , Segura A , Plesiat P , Jeannot K , Ramos JL
Ref : PLoS ONE , 9 :e81604 , 2014
Abstract : Molina_2014_PLoS.One_9_e81604
ESTHER : Molina_2014_PLoS.One_9_e81604
PubMedSearch : Molina_2014_PLoS.One_9_e81604
PubMedID: 24465371
Gene_locus related to this paper: psepu-PIP , psepu-PP4249 , psepu-PP4916 , psepu-q9wwz4

Title : The Complete Genome Sequence of Pseudomonas putida NBRC 14164T Confirms High Intraspecies Variation - Ohji_2014_Genome.Announc_2_e00029
Author(s) : Ohji S , Yamazoe A , Hosoyama A , Tsuchikane K , Ezaki T , Fujita N
Ref : Genome Announc , 2 : , 2014
Abstract : Ohji_2014_Genome.Announc_2_e00029
ESTHER : Ohji_2014_Genome.Announc_2_e00029
PubMedSearch : Ohji_2014_Genome.Announc_2_e00029
PubMedID: 24526630
Gene_locus related to this paper: psepu-PIP , psepu-PP3943 , psepu-PP4249 , psepu-q9wwz4

Title : Metabolic potential of the organic-solvent tolerant Pseudomonas putida DOT-T1E deduced from its annotated genome - Udaondo_2013_Microb.Biotechnol_6_598
Author(s) : Udaondo Z , Molina L , Daniels C , Gomez MJ , Molina-Henares MA , Matilla MA , Roca A , Fernandez M , Duque E , Segura A , Ramos JL
Ref : Microb Biotechnol , 6 :598 , 2013
Abstract : Udaondo_2013_Microb.Biotechnol_6_598
ESTHER : Udaondo_2013_Microb.Biotechnol_6_598
PubMedSearch : Udaondo_2013_Microb.Biotechnol_6_598
PubMedID: 23815283
Gene_locus related to this paper: psepu-PIP , psepu-PP3943 , psepu-PP4249 , psepu-q9wwz4

Title : Draft Genome Sequence of Medium-Chain-Length Polyhydroxyalkanoate-Producing Pseudomonas putida Strain LS46 - Sharma_2013_Genome.Announc_1_e0015113
Author(s) : Sharma PK , Fu J , Zhang X , Fristensky BW , Davenport K , Chain PS , Sparling R , Levin DB
Ref : Genome Announc , 1 :e0015113 , 2013
Abstract : Sharma_2013_Genome.Announc_1_e0015113
ESTHER : Sharma_2013_Genome.Announc_1_e0015113
PubMedSearch : Sharma_2013_Genome.Announc_1_e0015113
PubMedID: 23599293
Gene_locus related to this paper: psepu-PIP , psepu-PP1500 , psepu-PP4249 , psepu-q9wwz4

Title : Complete Genome Sequence of a Pseudomonas putida Clinical Isolate, Strain H8234 - Molina_2013_Genome.Announc_1_e00496
Author(s) : Molina L , Bernal P , Udaondo Z , Segura A , Ramos JL
Ref : Genome Announc , 1 :e00496 , 2013
Abstract : Molina_2013_Genome.Announc_1_e00496
ESTHER : Molina_2013_Genome.Announc_1_e00496
PubMedSearch : Molina_2013_Genome.Announc_1_e00496
PubMedID: 23868128
Gene_locus related to this paper: psepu-PIP , psepu-PP1500 , psepu-PP3943 , psepu-PP4249 , psepu-q9wwz4

Title : Dechlorination of chloral hydrate is influenced by the biofilm adhesin protein LapA in Pseudomonas putida LF54 - Zhang_2013_Appl.Environ.Microbiol_79_4166
Author(s) : Zhang W , Huhe , Pan Y , Toyofuku M , Nomura N , Nakajima T , Uchiyama H
Ref : Applied Environmental Microbiology , 79 :4166 , 2013
Abstract : Zhang_2013_Appl.Environ.Microbiol_79_4166
ESTHER : Zhang_2013_Appl.Environ.Microbiol_79_4166
PubMedSearch : Zhang_2013_Appl.Environ.Microbiol_79_4166
PubMedID: 23603683
Gene_locus related to this paper: psepu-PIP , psepu-PP1500 , psepu-PP4249 , psepu-q9wwz4 , psepu-u2t3m5

Title : Complete genome sequence of the naphthalene-degrading Pseudomonas putida strain ND6 - Li_2012_J.Bacteriol_194_5154
Author(s) : Li S , Zhao H , Li Y , Niu S , Cai B
Ref : Journal of Bacteriology , 194 :5154 , 2012
Abstract : Li_2012_J.Bacteriol_194_5154
ESTHER : Li_2012_J.Bacteriol_194_5154
PubMedSearch : Li_2012_J.Bacteriol_194_5154
PubMedID: 22933774
Gene_locus related to this paper: psepu-PIP , psepu-PP3943 , psepu-PP4249 , psepu-q9wwz4

Title : Kinetics of medium-chain-length polyhydroxyalkanoate production by a novel isolate of Pseudomonas putida LS46 - Sharma_2012_Can.J.Microbiol_58_982
Author(s) : Sharma PK , Fu J , Cicek N , Sparling R , Levin DB
Ref : Can J Microbiol , 58 :982 , 2012
Abstract : Sharma_2012_Can.J.Microbiol_58_982
ESTHER : Sharma_2012_Can.J.Microbiol_58_982
PubMedSearch : Sharma_2012_Can.J.Microbiol_58_982
PubMedID: 22804681
Gene_locus related to this paper: psepu-PIP , psepu-PP1500 , psepu-PP4249 , psepu-q9wwz4

Title : Complete genome of the plant growth-promoting rhizobacterium Pseudomonas putida BIRD-1 - Matilla_2011_J.Bacteriol_193_1290
Author(s) : Matilla MA , Pizarro-Tobias P , Roca A , Fernandez M , Duque E , Molina L , Wu X , van der Lelie D , Gomez MJ , Segura A , Ramos JL
Ref : Journal of Bacteriology , 193 :1290 , 2011
Abstract : Matilla_2011_J.Bacteriol_193_1290
ESTHER : Matilla_2011_J.Bacteriol_193_1290
PubMedSearch : Matilla_2011_J.Bacteriol_193_1290
PubMedID: 21183676
Gene_locus related to this paper: psepk-q88nk6 , psepk-q88qt0 , psepu-ESTB , psepu-PHAC1 , psepu-PHAZ , psepu-PIP , psepu-PP1184 , psepu-PP1500 , psepu-PP3807 , psepu-PP3812 , psepu-PP4178 , psepu-PP4249 , psepu-PP4551 , psepu-PP4583 , psepu-PP4634 , psepu-PP4916 , psepu-PP5117 , psepu-PP5161 , psepu-PP5167 , psepu-PPSD , psepu-q9wwz4

Title : Complete genome sequence of the nicotine-degrading Pseudomonas putida strain S16 - Yu_2011_J.Bacteriol_193_5541
Author(s) : Yu H , Tang H , Wang L , Yao Y , Wu G , Xu P
Ref : Journal of Bacteriology , 193 :5541 , 2011
Abstract : Yu_2011_J.Bacteriol_193_5541
ESTHER : Yu_2011_J.Bacteriol_193_5541
PubMedSearch : Yu_2011_J.Bacteriol_193_5541
PubMedID: 21914868
Gene_locus related to this paper: psep6-f8g0m2 , psepu-PIP , psepu-PP4249 , psepu-PP4916 , psepu-q9wwz4

Title : Complete genome sequence and comparative analysis of the metabolically versatile Pseudomonas putida KT2440 - Nelson_2002_Environ.Microbiol_4_799
Author(s) : Nelson KE , Weinel C , Paulsen IT , Dodson RJ , Hilbert H , Martins dos Santos VA , Fouts DE , Gill SR , Pop M , Holmes M , Brinkac L , Beanan M , DeBoy RT , Daugherty S , Kolonay J , Madupu R , Nelson W , White O , Peterson J , Khouri H , Hance I , Chris Lee P , Holtzapple E , Scanlan D , Tran K , Moazzez A , Utterback T , Rizzo M , Lee K , Kosack D , Moestl D , Wedler H , Lauber J , Stjepandic D , Hoheisel J , Straetz M , Heim S , Kiewitz C , Eisen JA , Timmis KN , Dusterhoft A , Tummler B , Fraser CM
Ref : Environ Microbiol , 4 :799 , 2002
Abstract : Nelson_2002_Environ.Microbiol_4_799
ESTHER : Nelson_2002_Environ.Microbiol_4_799
PubMedSearch : Nelson_2002_Environ.Microbiol_4_799
PubMedID: 12534463
Gene_locus related to this paper: psep1-a5wa77 , psep1-a5wax1 , psepk-q88nk6 , psepk-q88qt0 , psepu-acoc , psepu-BIOH , psepu-bpest , psepu-ESTB , psepu-LIP , psepu-METX , psepu-PHAC1 , psepu-PHAC2 , psepu-PHAG , psepu-PHAZ , psepu-PIP , psepu-PP0375 , psepu-PP0498 , psepu-PP0532 , psepu-PP1064 , psepu-PP1184 , psepu-PP1310 , psepu-PP1500 , psepu-PP1617 , psepu-PP1829 , psepu-PP1979 , psepu-PP2083 , psepu-PP2201 , psepu-PP2236 , psepu-PP2567 , psepu-PP2804 , psepu-PP2934 , psepu-PP3195 , psepu-PP3367 , psepu-PP3404 , psepu-PP3645 , psepu-PP3807 , psepu-PP3812 , psepu-PP3943 , psepu-PP4164 , psepu-PP4165 , psepu-PP4178 , psepu-PP4249 , psepu-PP4540 , psepu-PP4551 , psepu-PP4583 , psepu-PP4624 , psepu-PP4634 , psepu-PP4916 , psepu-PP5117 , psepu-PP5161 , psepu-PP5167 , psepu-PPSD , psepu-Q8KQK1 , psepu-q9wwz4

Title : Efflux pumps involved in toluene tolerance in Pseudomonas putida DOT-T1E - Ramos_1998_J.Bacteriol_180_3323
Author(s) : Ramos JL , Duque E , Godoy P , Segura A
Ref : Journal of Bacteriology , 180 :3323 , 1998
Abstract : Ramos_1998_J.Bacteriol_180_3323
ESTHER : Ramos_1998_J.Bacteriol_180_3323
PubMedSearch : Ramos_1998_J.Bacteriol_180_3323
PubMedID: 9642183
Gene_locus related to this paper: psepu-q9wwz4