9acto-d4q9n1

 
Thermobifida alba Esterase est1 TaEST1

Relationship
Block L
Thermobifida alba position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptosporangiales: N E > Nocardiopsaceae: N E > Thermobifida: N E > Thermobifida alba: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : BAI99230, AB445476
1 UniProt : D4Q9N1
1 UniProtTrembl : D4Q9N1
1 Interpro : D4Q9N1
1 Prodom : D4Q9N1
1 Pfam : D4Q9N1
1 PIRSF : D4Q9N1
1 SUPERFAM : D4Q9N1
1 QuickSwissBlast : D4Q9N1
 
Sequence
Graphical view for this peptide sequence: 9acto-d4q9n1
Colored MSA for Polyesterase-lipase-cutinase (raw)
MSVTTPRREASLLSRAVAVAAAAAATVALAAPAQAANPYERGPNPTESML
EARSGPFSVSEERASRLGADGFGGGTIYYPRENNTYGAIAISPGYTGTQS
SIAWLGERIASHGFVVIAIDTNTTLDQPDSRARQLNAALDYMLTDASSSV
RNRIDASRLAVMGHSMGGGGTLRLASQRPDLKAAIPLTPWHLNKSWRDIT
VPTLIIGADLDTIAPVSSHSEPFYNSIPSSTDKAYLELNNATHFAPNITN
KTIGMYSVAWLKRFVDEDTRYTQFLCPGPRTGLLSDVDEYRSTCPF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSVTTPRREASLLSRAVAVAAAAAATVALAAPAQAANPYERGPNPTESML
EARSGPFSVSEERASRLGADGFGGGTIYYPRENNTYGAIAISPGYTGTQS
SIAWLGERIASHGFVVIAIDTNTTLDQPDSRARQLNAALDYMLTDASSSV
RNRIDASRLAVMGHSMGGGGTLRLASQRPDLKAAIPLTPWHLNKSWRDIT
VPTLIIGADLDTIAPVSSHSEPFYNSIPSSTDKAYLELNNATHFAPNITN
KTIGMYSVAWLKRFVDEDTRYTQFLCPGPRTGLLSDVDEYRSTCPF

no DNA




References
1 more
    Title: Perspectives on the Role of Enzymatic Biocatalysis for the Degradation of Plastic PET
    Magalhaes RP, Cunha JM, Sousa SF
    Ref: Int J Mol Sci, 22:11257, 2021 : PubMed

            

    Title: Gene structure and comparative study of two different plastic-degrading esterases fromRoseateles depolymeransstrain TB-87
    Ahmad A, Tsutsui A, Iijim S, Suzuki T, Shaha AA, Nakajima-kambe T
    Ref: Polymer Degradation and Stability, 164:109, 2019 : PubMed

            

    Title: Diversity of polyester-degrading bacteria in compost and molecular analysis of a thermoactive esterase from Thermobifida alba AHK119
    Hu X, Thumarat U, Zhang X, Tang M, Kawai F
    Ref: Applied Microbiology & Biotechnology, 87:771, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer