Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-a0a0b5kns5

bacterium enrichment culture EH112 clone fosmid MGS-K1. Carboxylic ester hydrolase

Comment
EH112 promiscuous activity 8/96 substrates Martinez-Martinez et al. 2018


Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|bacterium enrichment culture clone fosmid MGS-K1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > bacterium enrichment culture clone fosmid MGS-K1: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KF831421
1 UniProt : A0A0B5KNS5
1 UniProt : A0A0B5KNS5
1 Interpro : A0A0B5KNS5
1 Prodom : A0A0B5KNS5
1 Pfam : A0A0B5KNS5
1 PIRSF : A0A0B5KNS5
1 SUPERFAM : A0A0B5KNS5
Sequence
Graphical view for this peptide sequence: 9bact-a0a0b5kns5
Colored MSA for Carb_B_Bacteria (raw)
MSNNKQTVVDTRAGKIEGYYKEGLYVFKGIPYAAPPVGELRWMPPQPVKP
WEGTLQAKQFGPIAPQNEMEGGMIPPAPPQTQNEDCLFLNIWTPGLDDAR
RPVMVWIHGGAFTIGSSSEPMYKASRLAARGDIVLVTINYRLGMLGFLNL
REVTKGKIPATGNEGLLDQLAALNWVKENIAAFGGDPTNVTVFGESAGAM
SIGCLMAMPKAKGYFHKAILESGVGSTAIPLDEAVDTARQFLETTGIKGD
DVKALHELTVKDLLEAEMELRTAMAGPGEVARITVTSPVIDGELIPDVPN
ELARRGSAKEVPTIIGTNLEEWKLFGIMQPDINELNEAEIVSRLSQFMSA
GDAREIVKTYREARQERGEPATPFELLSAVNTDLMFRIPALGLVEAQRDN
GQLAYNYLFDWKSPVMNGAIGACHALEIGFVFGQYNDMFCGSGPDADKLS
GCIQDAWTTFARTGDPSCESIGKWPIYGENRMTMTLGKNCHVEEAPYEQE
RQAWENISYKSAMP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSNNKQTVVDTRAGKIEGYYKEGLYVFKGIPYAAPPVGELRWMPPQPVKP
WEGTLQAKQFGPIAPQNEMEGGMIPPAPPQTQNEDCLFLNIWTPGLDDAR
RPVMVWIHGGAFTIGSSSEPMYKASRLAARGDIVLVTINYRLGMLGFLNL
REVTKGKIPATGNEGLLDQLAALNWVKENIAAFGGDPTNVTVFGESAGAM
SIGCLMAMPKAKGYFHKAILESGVGSTAIPLDEAVDTARQFLETTGIKGD
DVKALHELTVKDLLEAEMELRTAMAGPGEVARITVTSPVIDGELIPDVPN
ELARRGSAKEVPTIIGTNLEEWKLFGIMQPDINELNEAEIVSRLSQFMSA
GDAREIVKTYREARQERGEPATPFELLSAVNTDLMFRIPALGLVEAQRDN
GQLAYNYLFDWKSPVMNGAIGACHALEIGFVFGQYNDMFCGSGPDADKLS
GCIQDAWTTFARTGDPSCESIGKWPIYGENRMTMTLGKNCHVEEAPYEQE
RQAWENISYKSAMP


References
    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            

    Title: Pressure adaptation is linked to thermal adaptation in salt-saturated marine habitats
    Alcaide M, Stogios PJ, Lafraya A, Tchigvintsev A, Flick R, Bargiela R, Chernikova TN, Reva ON, Hai T and Ferrer M <11 more author(s)>
    Ref: Environ Microbiol, 17:332, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer