Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-a0a0h4tgu6

uncultured bacterium EH58 Alpha/beta hydrolase fold protein LIPESV12_9 LIPESV12_24

Comment
EH58 promiscuous activity 21/96 substrates Martinez-Martinez et al. 2018


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : KR778890, KP861227
1 UniProt : A0A0H4TGU6
1 UniProt : A0A0H4TGU6
1 Interpro : A0A0H4TGU6
1 Prodom : A0A0H4TGU6
1 Pfam : A0A0H4TGU6
1 PIRSF : A0A0H4TGU6
1 SUPERFAM : A0A0H4TGU6
Sequence
Graphical view for this peptide sequence: 9bact-a0a0h4tgu6
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MTITTSERTRPMWQEHIAGRKIGLETGPRPFDPHKPCLLMVHGSGGRGET
FRPQLSGLAPYLNPAAIDLPGHGNTPGPGRDQVAHYADWLAEFIRRGPLR
PALLGHSLGGAIVMQLALDHPDLAPALVLVGTGSRLRVLPAILDGLLSDF
DATLDLVLKYAYAPGADPRWVQAGREIMSQPGPRVVHDDFAACDRYDITD
RLGEITAPTLLIYGDQDQLTPPKYGRFLAERLPDARLEIVAGAGHMVNLE
RHAEVNRLIHPFISAFSPPASS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTITTSERTRPMWQEHIAGRKIGLETGPRPFDPHKPCLLMVHGSGGRGET
FRPQLSGLAPYLNPAAIDLPGHGNTPGPGRDQVAHYADWLAEFIRRGPLR
PALLGHSLGGAIVMQLALDHPDLAPALVLVGTGSRLRVLPAILDGLLSDF
DATLDLVLKYAYAPGADPRWVQAGREIMSQPGPRVVHDDFAACDRYDITD
RLGEITAPTLLIYGDQDQLTPPKYGRFLAERLPDARLEIVAGAGHMVNLE
RHAEVNRLIHPFISAFSPPASS


References
    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            

    Title: Diversity of hydrolases from hydrothermal vent sediments of the Levante Bay, Vulcano Island (Aeolian archipelago) identified by activity-based metagenomics and biochemical characterization of new esterases and an arabinopyranosidase
    Placido A, Hai T, Ferrer M, Chernikova TN, Distaso M, Armstrong D, Yakunin AF, Toshchakov SV, Yakimov MM and Golyshin PN <4 more author(s)>
    Ref: Applied Microbiology & Biotechnology, 99:10031, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer