Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-AtD14

Arabidopsis thaliana (Mouse-ear cress) t11i18.10 protein (At3g03990/T11I18.10) AtD14 DWARF14

Comment
Orthologue to rice OsD14 and paralogue to KAI2


Relationship
Family|RsbQ-like
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
4 structures (e.g. : 4IH4, 4JYM, 4JYP... more)
No kinetic





3 substrates: Contalactone, GR24, Karrikin-1
No inhibitor
>3 Genbank links 1 more: AC011698, AY064145, AY097402
>3 Structure links 1 more: 4JYP, 4JYM, 4IH4
1 UniProt : Q9SQR3
1 Interpro : Q9SQR3
1 Prodom : Q9SQR3
1 Pfam : Q9SQR3
1 PIRSF : Q9SQR3
1 SUPERFAM : Q9SQR3
1 Tair database : At3g03990
Sequence
Graphical view for this peptide sequence: arath-AtD14
Colored MSA for RsbQ-like (raw)
MSQHNILEALNVRVVGTGDRILFLAHGFGTDQSAWHLILPYFTQNYRVVL
YDLVCAGSVNPDYFDFNRYTTLDPYVDDLLNIVDSLGIQNCAYVGHSVSA
MIGIIASIRRPELFSKLILIGFSPRFLNDEDYHGGFEEGEIEKVFSAMEA
NYEAWVHGFAPLAVGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLR
GVLGLVRVPTCVIQTAKDVSVPASVAEYLRSHLGGDTTVETLKTEGHLPQ
LSAPAQLAQFLRRALPR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSQHNILEALNVRVVGTGDRILFLAHGFGTDQSAWHLILPYFTQNYRVVL
YDLVCAGSVNPDYFDFNRYTTLDPYVDDLLNIVDSLGIQNCAYVGHSVSA
MIGIIASIRRPELFSKLILIGFSPRFLNDEDYHGGFEEGEIEKVFSAMEA
NYEAWVHGFAPLAVGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLR
GVLGLVRVPTCVIQTAKDVSVPASVAEYLRSHLGGDTTVETLKTEGHLPQ
LSAPAQLAQFLRRALPR


References
8 more
    Title: Desmethyl butenolides are optimal ligands for karrikin receptor proteins
    Yao J, Scaffidi A, Meng Y, Melville KT, Komatsu A, Khosla A, Nelson DC, Kyozuka J, Flematti GR, Waters MT
    Ref: New Phytol, :, 2021 : PubMed

            

    Title: Strigolactone perception and deactivation by a hydrolase receptor DWARF14
    Seto Y, Yasui R, Kameoka H, Tamiru M, Cao M, Terauchi R, Sakurada A, Hirano R, Kisugi T and Yamaguchi S <12 more author(s)>
    Ref: Nat Commun, 10:191, 2019 : PubMed

            

    Title: Full-length messenger RNA sequences greatly improve genome annotation
    Haas BJ, Volfovsky N, Town CD, Troukhan M, Alexandrov N, Feldmann KA, Flavell RB, White O, Salzberg SL
    Ref: Genome Biol, 3:RESEARCH0029, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer