Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-q9fij5

Arabidopsis thaliana (Mouse-ear cress); Arabidopsis lyrata;Capsella rubella Uncharacterized protein AT5g47860/MCA23_20

Comment
Other strains: Arabidopsis thaliana (Mouse-ear cress); Capsella rubella; Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)


Relationship
Family|Duf_1350
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AY058159, AY142015, AB016886
1 UniProt : Q9FIJ5
>3 UniProt links 1 more: Q9FIJ5, A0A178UA96, R0EWV8
>3 Interpro links 1 more: Q9FIJ5, A0A178UA96, R0EWV8
>3 Prodom links 1 more: Q9FIJ5, A0A178UA96, R0EWV8
>3 Pfam links 1 more: Q9FIJ5, A0A178UA96, R0EWV8
>3 PIRSF links 1 more: Q9FIJ5, A0A178UA96, R0EWV8
>3 SUPERFAM links 1 more: Q9FIJ5, A0A178UA96, R0EWV8
1 Tair database : At5g47860
Sequence
Graphical view for this peptide sequence: arath-q9fij5
Colored MSA for Duf_1350 (raw)
MATCSLLPPPSFSPRRRFCSFSHNRRSLPSIFSFNKERVSRRVFCSSKEN
DINRDRNQSTGIQVYGEIERLLTETVKNSQSSSGGSSDWSEVEGAWVLKP
RNSKPKMVVHFIGGIFVGAAPQLTYRLFLERLAEKDVLVIATPYASGFDH
FNIADEVQFKYDRCCRSLQEEVQDLPSFGIGHSLGSVIHLLIGSRYAVQR
NGNVFMAFNNKEASLAIPLFSPVLVPMAQSLGPLLSQVATSPTIRLGAEM
TRKQLETLSPPIMKQILPLVEQLPPLYMDLVKGREDFVPKPEETRRLIRS
YYGISRNLLIKFEDDSIDETSILAQVLGVESSISSKLDMSIRTLPGDHGL
PLQQALPDVPPGMAEAVNRGSEFLANIAVGTPWESMAKEVGGSLGMDSKI
LRADMSKDLAQLVDAITSWMISNMGPKLLRP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MATCSLLPPPSFSPRRRFCSFSHNRRSLPSIFSFNKERVSRRVFCSSKEN
DINRDRNQSTGIQVYGEIERLLTETVKNSQSSSGGSSDWSEVEGAWVLKP
RNSKPKMVVHFIGGIFVGAAPQLTYRLFLERLAEKDVLVIATPYASGFDH
FNIADEVQFKYDRCCRSLQEEVQDLPSFGIGHSLGSVIHLLIGSRYAVQR
NGNVFMAFNNKEASLAIPLFSPVLVPMAQSLGPLLSQVATSPTIRLGAEM
TRKQLETLSPPIMKQILPLVEQLPPLYMDLVKGREDFVPKPEETRRLIRS
YYGISRNLLIKFEDDSIDETSILAQVLGVESSISSKLDMSIRTLPGDHGL
PLQQALPDVPPGMAEAVNRGSEFLANIAVGTPWESMAKEVGGSLGMDSKI
LRADMSKDLAQLVDAITSWMISNMGPKLLRP


Reference
    Title: Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana
    Tabata S, Kaneko T, Nakamura Y, Kotani H, Kato T, Asamizu E, Miyajima N, Sasamoto S, Kimura T and Fransz P <119 more author(s)>
    Ref: Nature, 408:823, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer