Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspa1-acui

Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094). Aculin biosynthesis cluster protein I

Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Aspergillus aculeatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus subgen. Circumdati: N E > Aspergillus aculeatus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : KV878982, XP_020053923
1 UniProt : A0A1L9WN42
1 UniProt : A0A1L9WN42
1 Interpro : A0A1L9WN42
1 Pfam : A0A1L9WN42
1 PIRSF : A0A1L9WN42
1 SUPERFAM : A0A1L9WN42
Sequence
Graphical view for this peptide sequence: aspa1-acui
Colored MSA for Carboxypeptidase_S10 (raw)
MLLPSFPVTGVATALLLRNAVHASQPGSSVQKARAYDRFSSRPTRDHAPR
VQSSNTSTYRFWNDKTKPHLVESLPDVHFDLGEMYSGSINITSHRNESRS
LFYIFQPKIGEPSDDLTIYLNGGPGCSSEQAFFQENGRFTWQPGTYAPVI
NQYSWVNLTNMLWVDQPVGTGYSVGTPTATNEAEVAADFLEFFSKFQDLY
GIKNFRIFVSGESYAGRYVPYISSAMLDKNDTTHFNLSGKPAHPLHHLAP
TNAVCTGALLYDACIGQWDWVQAELPAYPFVQQHASLFNFNETFMTSLAT
TYEECGYQAYFDEYFTFPASGIQPPKYMNYSECDIYNAIYNEAFSPNPCF
NPYRVIDECPLLWDVLGFPTDLAYEPAPTTYFNRADVKRALHAPQNIEWE
LCSTDPVLVGGDGVSGPEQVGDDSPNPTEGSLPRVIEATNRVLIANGDWD
YLIITNGTLLAIQNMTWHGQLGFAAAPATPIDIRMPDLQWAGVFDAQEGY
GDLDGPQGVMGVQHYERGLMWAETFQAGHKQAQDQGRVSYRHLQWLLGEV
DSL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLLPSFPVTGVATALLLRNAVHASQPGSSVQKARAYDRFSSRPTRDHAPR
VQSSNTSTYRFWNDKTKPHLVESLPDVHFDLGEMYSGSINITSHRNESRS
LFYIFQPKIGEPSDDLTIYLNGGPGCSSEQAFFQENGRFTWQPGTYAPVI
NQYSWVNLTNMLWVDQPVGTGYSVGTPTATNEAEVAADFLEFFSKFQDLY
GIKNFRIFVSGESYAGRYVPYISSAMLDKNDTTHFNLSGKPAHPLHHLAP
TNAVCTGALLYDACIGQWDWVQAELPAYPFVQQHASLFNFNETFMTSLAT
TYEECGYQAYFDEYFTFPASGIQPPKYMNYSECDIYNAIYNEAFSPNPCF
NPYRVIDECPLLWDVLGFPTDLAYEPAPTTYFNRADVKRALHAPQNIEWE
LCSTDPVLVGGDGVSGPEQVGDDSPNPTEGSLPRVIEATNRVLIANGDWD
YLIITNGTLLAIQNMTWHGQLGFAAAPATPIDIRMPDLQWAGVFDAQEGY
GDLDGPQGVMGVQHYERGLMWAETFQAGHKQAQDQGRVSYRHLQWLLGEV
DSL


References
    Title: Comparative genomics reveals high biological diversity and specific adaptations in the industrially and medically important fungal genus Aspergillus
    de Vries RP, Riley R, Wiebenga A, Aguilar-Osorio G, Amillis S, Uchima CA, Anderluh G, Asadollahi M, Askin M and Grigoriev IV <107 more author(s)>
    Ref: Genome Biol, 18:28, 2017 : PubMed

            

    Title: Investigation of a 6-MSA Synthase Gene Cluster in Aspergillus aculeatus Reveals 6-MSA-derived Aculinic Acid, Aculins A-B and Epi-Aculin A
    Petersen LM, Holm DK, Gotfredsen CH, Mortensen UH, Larsen TO
    Ref: Chembiochem, 16:2200, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer