Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brusu-BR1291

Brucella suis phospholipase/carboxylesterase family protein

Comment
Q8YHT6 DelVecchio et al. Brucella melitensis hypothetical protein bmei0710 identical


Relationship
Family|AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Brucella suis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Brucellaceae: N E > Brucella: N E > Brucella suis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AE014427, AE009512
1 UniProt : Q8YHT6
1 Interpro : Q8YHT6
1 Pfam : Q8YHT6
1 PIRSF : Q8YHT6
1 SUPERFAM : Q8YHT6
Sequence
Graphical view for this peptide sequence: brusu-BR1291
Colored MSA for AlphaBeta_hydrolase (raw)
MGKRETKRAISGLLSAFFLLRVSSAFAGDILPPFKDDYFAYPGILSSADN
GDYKVVDYDEMRDINGRDAVSEKRVRDAYVSLRARAYQKDVTFQTFAGPV
KAMTAGKRDGASFIVIYLHGRGGNRLQGMNDFTFGGNFNRVKNLAVLNDG
FYITPDFKDFGAAGEAQIAGLIDAVRATSPHAPLVLSCGSQGGTLCWRIA
ANEKAGGALAGLILLGSLWDEGFFQSSAFKRRVPVFFGHGSRDPVFAIDK
QEGFYREIRKRAPGYPVQFRRFESGNHGTPIRMSDWRETLNWILAKQG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGKRETKRAISGLLSAFFLLRVSSAFAGDILPPFKDDYFAYPGILSSADN
GDYKVVDYDEMRDINGRDAVSEKRVRDAYVSLRARAYQKDVTFQTFAGPV
KAMTAGKRDGASFIVIYLHGRGGNRLQGMNDFTFGGNFNRVKNLAVLNDG
FYITPDFKDFGAAGEAQIAGLIDAVRATSPHAPLVLSCGSQGGTLCWRIA
ANEKAGGALAGLILLGSLWDEGFFQSSAFKRRVPVFFGHGSRDPVFAIDK
QEGFYREIRKRAPGYPVQFRRFESGNHGTPIRMSDWRETLNWILAKQG


References
    Title: The genome sequence of the facultative intracellular pathogen Brucella melitensis
    DelVecchio VG, Kapatral V, Redkar RJ, Patra G, Mujer C, Los T, Ivanova N, Anderson I, Bhattacharyya A and Overbeek R <15 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:443, 2002 : PubMed

            

    Title: The Brucella suis genome reveals fundamental similarities between animal and plant pathogens and symbionts
    Paulsen IT, Seshadri R, Nelson KE, Eisen JA, Heidelberg JF, Read TD, Dodson RJ, Umayam L, Brinkac LM and Fraser CM <21 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:13148, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer