humin-cut

 
Humicola insolens (Soft-rot fungus) Cutinase (HiC) HiCut

Comment
Novozym 51032 Hydrolysis of triglycerides and a variety of molecules containing ester linkages. Specific hydrolytic activity on polyvinyl acetate .Catalyzed Polyester-Polyurethane degradation


Relationship
Family Cutinase
Block X
Humicola insolens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Sordariomycetidae: N E > Sordariales: N E > Chaetomiaceae: N E > Humicola: N E > Humicola insolens: N E

Molecular evidence
Database
1 Genbank : AAE13316
1 UniProt : A0A075B5G4
2 Structure : 4OYL, 4OYY
1 UniProtTrembl : A0A075B5G4
1 Interpro : A0A075B5G4
1 Prodom : A0A075B5G4
1 Pfam : A0A075B5G4
1 PIRSF : A0A075B5G4
1 SUPERFAM : A0A075B5G4
1 QuickSwissBlast : A0A075B5G4
 
Sequence
Graphical view for this peptide sequence: humin-cut
Colored MSA for Cutinase (raw)
QLGAIENGLESGSANACPDAILIFARGSTEPGNMGITVGPALANGLESHI
RNIWIQGVGGPYDAALATNFLPRGTSQANIDEGKRLFALANQKCPNTPVV
AGGYSQGAALIAAAVSELSGAVKEQVKGVALFGYTQNLQNRGGIPNYPRE
RTKVFCNVGDAVCTGTLIITPAHLSYTIEARGEAARFLRDRIRA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

QLGAIENGLESGSANACPDAILIFARGSTEPGNMGITVGPALANGLESHI
RNIWIQGVGGPYDAALATNFLPRGTSQANIDEGKRLFALANQKCPNTPVV
AGGYSQGAALIAAAVSELSGAVKEQVKGVALFGYTQNLQNRGGIPNYPRE
RTKVFCNVGDAVCTGTLIITPAHLSYTIEARGEAARFLRDRIRA

no DNA




References
14 more
    Title: Enhanced activity towards polyacrylates and poly(vinyl acetate) by site-directed mutagenesis of Humicola insolens cutinase
    Su L, Hong R, Kong D, Wu J
    Ref: Int J Biol Macromol, 162:1752, 2020 : PubMed

            

    Title: Substrate specificities of cutinases on aliphatic-aromatic polyesters and on their model substrates
    Perz V, Bleymaier K, Sinkel C, Kueper U, Bonnekessel M, Ribitsch D, Guebitz GM
    Ref: N Biotechnol, 33:295, 2016 : PubMed

            

    Title: Thermodynamic and structural investigation of the specific SDS binding of humicola insolens cutinase
    Kold D, Dauter Z, Laustsen AK, Brzozowski AM, Turkenburg JP, Nielsen AD, Koldso H, Petersen E, Schiott B and Wimmer R <3 more author(s)>
    Ref: Protein Science, 23:1023, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer