Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: hypjq-g0rh85

Hypocrea jecorina (strain QM6a) (Trichoderma reesei) cutinase

Comment
Catalyzes the hydrolysis of complex carboxylic polyesters found in the cell wall of plants. Degrades cutin, a macromolecule that forms the structure of the plant cuticle


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Hypocrea jecorina
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Hypocreaceae: N E > Trichoderma: N E > Trichoderma reesei: N E


Molecular evidence
Database
No mutation
3 structures: 4PSC, 4PSD, 4PSE
No kinetic





1 substrate:
Cutin
1 inhbitor:
C11Y4-phosphonate
1 Genbank : EGR49371
2 UniProt : G0RH85, A0A024SC78
3 Structure : 4PSC, 4PSD, 4PSE
2 UniProt : G0RH85, A0A024SC78
2 Interpro : G0RH85, A0A024SC78
2 Prodom : G0RH85, A0A024SC78
2 Pfam : G0RH85, A0A024SC78
2 PIRSF : G0RH85, A0A024SC78
2 SUPERFAM : G0RH85, A0A024SC78
Sequence
Graphical view for this peptide sequence: hypjq-g0rh85
Colored MSA for Cutinase (raw)
MRSLAILTTLLAGHAFAYPKPAPQSVNRRDWPSINEFLSELAKVMPIGDT
ITAACDLISDGEDAAASLFGISETENDPCGDVTVLFARGTCDPGNVGVLV
GPWFFDSLQTALGSRTLGVKGVPYPASVQDFLSGSVQNGINMANQIKSVL
QSCPNTKLVLGGYSQGSMVVHNAASNLDAATMSKISAVVLFGDPYYGKPV
ANFDAAKTLVVCHDGDNICQGGDIILLPHLTYAEDADTAAAFVVPLV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRSLAILTTLLAGHAFAYPKPAPQSVNRRDWPSINEFLSELAKVMPIGDT
ITAACDLISDGEDAAASLFGISETENDPCGDVTVLFARGTCDPGNVGVLV
GPWFFDSLQTALGSRTLGVKGVPYPASVQDFLSGSVQNGINMANQIKSVL
QSCPNTKLVLGGYSQGSMVVHNAASNLDAATMSKISAVVLFGDPYYGKPV
ANFDAAKTLVVCHDGDNICQGGDIILLPHLTYAEDADTAAAFVVPLV


References
    Title: A Cutinase from Trichoderma reesei with a Lid-Covered Active Site and Kinetic Properties of True Lipases
    Roussel A, Amara S, Nyyssola A, Mateos-Diaz E, Blangy S, Kontkanen H, Westerholm-Parvinen A, Carriere F, Cambillau C
    Ref: Journal of Molecular Biology, 426:3757, 2014 : PubMed

            

    Title: Genome sequencing and analysis of the biomass-degrading fungus Trichoderma reesei (syn. Hypocrea jecorina)
    Martinez D, Berka RM, Henrissat B, Saloheimo M, Arvas M, Baker SE, Chapman J, Chertkov O, Coutinho PM and Brettin TS <35 more author(s)>
    Ref: Nat Biotechnol, 26:553, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer