Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: medtr-g7inw6

Medicago truncatula (Barrel medic) (Medicago tribuloides). Putative acylglycerol lipase

Relationship
Family|TGL-GrainShapeFactor
Block| X
Position in NCBI Life Tree|Medicago truncatula
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Fabales: N E > Fabaceae: N E > Papilionoideae: N E > Trifolieae: N E > Medicago: N E > Medicago truncatula: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CM001218, PSQE01000002, XP_003593204.2
1 UniProt : G7INW6
2 UniProt : G7INW6, A0A0C3UWG6
2 Interpro : G7INW6, A0A0C3UWG6
2 Pfam : G7INW6, A0A0C3UWG6
2 PIRSF : G7INW6, A0A0C3UWG6
2 SUPERFAM : G7INW6, A0A0C3UWG6
Sequence
Graphical view for this peptide sequence: medtr-g7inw6
Colored MSA for TGL-GrainShapeFactor (raw)
MLSKFSKCVSFAASRDWLYRHSFTVAGLRSVVTDLGDGTTMHCWVPKLHN
PCKPSLVLVHGFGANAMWQYGEHLHHFIRQFNLYVPDLLFFGGSFTSRPE
RTESFQALCLKKLMEAHGVNRLSLVGISYGGFVGYSLAAQFPEVVEKLAL
CCAGVCLEEIDMKNGLFRVSSLEEACSILLPQTPDRLRELMRLSFVRPAR
AVPSWFLEDFIRVMCTDHIEQKRELLEAILKGRQFSNLPKIKQKPTLIMW
GEQDQIFPLELGARLKRHIGENAQMVVIKNAGHALNIEKSKEFARHLKSF
LIDAGSRPSSPPTLKEQIQKTFWFDFSKS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLSKFSKCVSFAASRDWLYRHSFTVAGLRSVVTDLGDGTTMHCWVPKLHN
PCKPSLVLVHGFGANAMWQYGEHLHHFIRQFNLYVPDLLFFGGSFTSRPE
RTESFQALCLKKLMEAHGVNRLSLVGISYGGFVGYSLAAQFPEVVEKLAL
CCAGVCLEEIDMKNGLFRVSSLEEACSILLPQTPDRLRELMRLSFVRPAR
AVPSWFLEDFIRVMCTDHIEQKRELLEAILKGRQFSNLPKIKQKPTLIMW
GEQDQIFPLELGARLKRHIGENAQMVVIKNAGHALNIEKSKEFARHLKSF
LIDAGSRPSSPPTLKEQIQKTFWFDFSKS


References
    Title: Whole-genome landscape of Medicago truncatula symbiotic genes
    Pecrix Y, Staton SE, Sallet E, Lelandais-Briere C, Moreau S, Carrere S, Blein T, Jardinaud MF, Latrasse D and Gamas P <22 more author(s)>
    Ref: Nat Plants, 4:1017, 2018 : PubMed

            

    Title: An improved genome release (version Mt4.0) for the model legume Medicago truncatula
    Tang H, Krishnakumar V, Bidwell S, Rosen B, Chan A, Zhou S, Gentzbittel L, Childs KL, Yandell M and Town CD <3 more author(s)>
    Ref: BMC Genomics, 15:312, 2014 : PubMed

            

    Title: The Medicago genome provides insight into the evolution of rhizobial symbioses
    Young ND, Debelle F, Oldroyd GE, Geurts R, Cannon SB, Udvardi MK, Benedito VA, Mayer KF, Gouzy J and Roe BA <114 more author(s)>
    Ref: Nature, 480:520, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer