Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: medtr-g7j3q3

Medicago truncatula (Barrel medic) (Medicago tribuloides). Putative acylglycerol lipase

Comment
Hydrolysis rates in blood and red blood cells (RBC) were much higher than in plasma, suggesting that esterases located in the RBC are most important in the blood metabolism of clevidipine


Relationship
Family|TGL-GrainShapeFactor
Block| X
Position in NCBI Life Tree|Medicago truncatula
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Fabales: N E > Fabaceae: N E > Papilionoideae: N E > Trifolieae: N E > Medicago: N E > Medicago truncatula: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CM001219, PSQE01000003, XP_003601937
1 UniProt : G7J3Q3
1 UniProt : G7J3Q3
1 Interpro : G7J3Q3
1 Pfam : G7J3Q3
1 PIRSF : G7J3Q3
1 SUPERFAM : G7J3Q3
Sequence
Graphical view for this peptide sequence: medtr-g7j3q3
Colored MSA for TGL-GrainShapeFactor (raw)
MGSSRWFSFTTLCNWWFRYSFSKSGLKSTTTDLGDGTVMHCWVPKTAQKH
KPSLILIHGIGANAMWQWNSFIPELTHHFNVYVPDLLFFGDSYTTRPERS
EQFQAKCVMRVLEGHGVRGMMVVGLSYGGFVGYSMAAMFPEKVEKAVVIC
AGVCLEDRDMDDGMFQVKSVDEAVDVLLPLTPEMMKELVKLTFFKPVKTL
PNWFLNDFIEVMCIEYRQERKELIQALHKDRNLSNLPKITQPMQIIWGEH
DRVFPLELAHRLKRHVGEKAQLVVIEDAGHAINAEKPKEMYKNLNSFLIH
PFTGSKQENHSNGYKFE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGSSRWFSFTTLCNWWFRYSFSKSGLKSTTTDLGDGTVMHCWVPKTAQKH
KPSLILIHGIGANAMWQWNSFIPELTHHFNVYVPDLLFFGDSYTTRPERS
EQFQAKCVMRVLEGHGVRGMMVVGLSYGGFVGYSMAAMFPEKVEKAVVIC
AGVCLEDRDMDDGMFQVKSVDEAVDVLLPLTPEMMKELVKLTFFKPVKTL
PNWFLNDFIEVMCIEYRQERKELIQALHKDRNLSNLPKITQPMQIIWGEH
DRVFPLELAHRLKRHVGEKAQLVVIEDAGHAINAEKPKEMYKNLNSFLIH
PFTGSKQENHSNGYKFE


References
    Title: Whole-genome landscape of Medicago truncatula symbiotic genes
    Pecrix Y, Staton SE, Sallet E, Lelandais-Briere C, Moreau S, Carrere S, Blein T, Jardinaud MF, Latrasse D and Gamas P <22 more author(s)>
    Ref: Nat Plants, 4:1017, 2018 : PubMed

            

    Title: An improved genome release (version Mt4.0) for the model legume Medicago truncatula
    Tang H, Krishnakumar V, Bidwell S, Rosen B, Chan A, Zhou S, Gentzbittel L, Childs KL, Yandell M and Town CD <3 more author(s)>
    Ref: BMC Genomics, 15:312, 2014 : PubMed

            

    Title: The Medicago genome provides insight into the evolution of rhizobial symbioses
    Young ND, Debelle F, Oldroyd GE, Geurts R, Cannon SB, Udvardi MK, Benedito VA, Mayer KF, Gouzy J and Roe BA <114 more author(s)>
    Ref: Nature, 480:520, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer