Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-2neur

Mus musculus (Mouse) neuroligin 2 (Nlgn2), mRNA

Comment
gene Ensembl ENSMUSG00000019462 on chromosome 11


Relationship
Family|Neuroligin
Block| C
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
1 mutation: mouse-2neur
1 structure:
3BL8: Crystal structure of the extracellular domain of neuroligin-2A from mouse
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: BC056478, NM_198862, AK173159
2 UniProt : Q69ZK9, F6VE93
2 Ncbi-nid : 38524605, 50510902
2 Ncbi-pid : 38524606, 50510903
1 Structure : 3BL8
3 UniProt : Q6PHN2, Q69ZK9, F6VE93
3 Interpro : Q6PHN2, Q69ZK9, F6VE93
3 Prodom : Q6PHN2, Q69ZK9, F6VE93
3 Pfam : Q6PHN2, Q69ZK9, F6VE93
3 PIRSF : Q6PHN2, Q69ZK9, F6VE93
3 SUPERFAM : Q6PHN2, Q69ZK9, F6VE93
1 ENSEMBL : ENSMUSG00000019462
Sequence
Graphical view for this peptide sequence: mouse-2neur
Colored MSA for Neuroligin (raw)
MWLLALCLVGLAGAQRGGGGPGGGAPGGPGLGLGSLGEERFPVVNTAYGR
VRGVRRELNNEILGPVVQFLGVPYATPPLGARRFQPPEAPASWPGVRNAT
TLPPACPQNLHGALPAIMLPVWFTDNLEAAATYVQNQSEDCLYLNLYVPT
EDGPLTKKRDEATLNPPDTDIRDSGKKPVMLFLHGGSYMEGTGNMFDGSV
LAAYGNVIVVTLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWLSENIA
HFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSV
NYQPLKYTRLLAAKVGCDREDSTEAVECLRRKSSRELVDQDVQPARYHIA
FGPVVDGDVVPDDPEILMQQGEFLNYDMLIGVNQGEGLKFVEDSAESEDG
VSASAFDFTVSNFVDNLYGYPEGKDVLRETIKFMYTDWADRDNGEMRRKT
LLALFTDHQWVAPAVATAKLHADYQSPVYFYTFYHHCQAEGRPEWADAAH
GDELPYVFGVPMVGATDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNQP
VPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGLKPRVRDNYRANKVAF
WLELVPHLHNLHTELFTTTTRLPPYATRWPPRTPGPGTSGTRRPPPPATL
PPESDIDLGPRAYDRFPGDSRDYSTELSVTVAVGASLLFLNILAFAALYY
KRDRRQELRCRRLSPPGGSGSGVPGGGPLLPTAGRELPPEEELVSLQLKR
GGGVGADPAEALRPACPPDYTLALRRAPDDVPLLAPGALTLLPSGLGPPP
PPPPPSLHPFGPFPPPPPTATSHNNTLPHPHSTTRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWLLALCLVGLAGAQRGGGGPGGGAPGGPGLGLGSLGEERFPVVNTAYGR
VRGVRRELNNEILGPVVQFLGVPYATPPLGARRFQPPEAPASWPGVRNAT
TLPPACPQNLHGALPAIMLPVWFTDNLEAAATYVQNQSEDCLYLNLYVPT
EDGPLTKKRDEATLNPPDTDIRDSGKKPVMLFLHGGSYMEGTGNMFDGSV
LAAYGNVIVVTLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWLSENIA
HFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSV
NYQPLKYTRLLAAKVGCDREDSTEAVECLRRKSSRELVDQDVQPARYHIA
FGPVVDGDVVPDDPEILMQQGEFLNYDMLIGVNQGEGLKFVEDSAESEDG
VSASAFDFTVSNFVDNLYGYPEGKDVLRETIKFMYTDWADRDNGEMRRKT
LLALFTDHQWVAPAVATAKLHADYQSPVYFYTFYHHCQAEGRPEWADAAH
GDELPYVFGVPMVGATDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNQP
VPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGLKPRVRDNYRANKVAF
WLELVPHLHNLHTELFTTTTRLPPYATRWPPRTPGPGTSGTRRPPPPATL
PPESDIDLGPRAYDRFPGDSRDYSTELSVTVAVGASLLFLNILAFAALYY
KRDRRQELRCRRLSPPGGSGSGVPGGGPLLPTAGRELPPEEELVSLQLKR
GGGVGADPAEALRPACPPDYTLALRRAPDDVPLLAPGALTLLPSGLGPPP
PPPPPSLHPFGPFPPPPPTATSHNNTLPHPHSTTRV


References
6 more
    Title: Lineage-specific biology revealed by a finished genome assembly of the mouse
    Church DM, Goodstadt L, Hillier LW, Zody MC, Goldstein S, She X, Bult CJ, Agarwala R, Cherry JL and Ponting CP <21 more author(s)>
    Ref: PLoS Biol, 7:e1000112, 2009 : PubMed

            

    Title: Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations
    Munton RP, Tweedie-Cullen R, Livingstone-Zatchej M, Weinandy F, Waidelich M, Longo D, Gehrig P, Potthast F, Rutishauser D and Mansuy IM <3 more author(s)>
    Ref: Mol Cell Proteomics, 6:283, 2007 : PubMed

            

    Title: Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries
    Okazaki N, R FK, Ohara R, Inamoto S, Koseki H, Hiraoka S, Saga Y, Seino S, Nishimura M and Koga H <5 more author(s)>
    Ref: DNA Research, 11:205, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer