Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: myolu-g1p353

Myotis lucifugus (Little brown bat); Myotis brandtii (Brandt's bat). Lipase H

Comment
Other strains: Myotis lucifugus (Little brown bat); Myotis brandtii (Brandt's bat)


Relationship
Family|Phospholipase
Block| L
Position in NCBI Life Tree|Myotis lucifugus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Chiroptera: N E > Microchiroptera: N E > Vespertilionidae: N E > Myotis: N E > Myotis lucifugus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AAPE02008571, KE161269
2 UniProt : G1P353, S7P5I2
2 UniProt : G1P353, S7P5I2
2 Interpro : G1P353, S7P5I2
2 Pfam : G1P353, S7P5I2
2 PIRSF : G1P353, S7P5I2
2 SUPERFAM : G1P353, S7P5I2
Sequence
Graphical view for this peptide sequence: myolu-g1p353
Colored MSA for Phospholipase (raw)
NLVFSLFLTPYLISISDTDGTCPSFTRLSFHSAVVGTGLRVKLMLYTRRD
PTCAQVINATALGNLNVTKRTTFIIHGFRPTGSPPVWIGDLVEGLLFIED
MNVIVVDWNRGATTVLYNKAADKTRKVATVLKKFIDHLLTKGASLDDIYM
IGVSLGAHISGFVGEEYNGKLGRITGLDPAGPLFNGKPPEDRLDPSDAQF
VDVIHSDIDALGYKEPLGNIDFYPNGGLDQPGCPKTIFGGMQYFKCDHQK
SVYLYLSSLRENCTVTAYPCDSYRDYRNGKCVSCGTPQTESCPLLGYFAD
NWKDYLTEKDPPMTKAYFDTAEEKPFCIYHYFVDIITWNKNIRRGSITIK
LKDKAGNTTESKIDHEPATFQKYHQVSLLARFSRDLDKVAAISLVFSTGS
VVGPRYKLRILRMKLRSLVHPERPQLCRYDLVLMENIETVFQPILCPKLQ
L
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

NLVFSLFLTPYLISISDTDGTCPSFTRLSFHSAVVGTGLRVKLMLYTRRD
PTCAQVINATALGNLNVTKRTTFIIHGFRPTGSPPVWIGDLVEGLLFIED
MNVIVVDWNRGATTVLYNKAADKTRKVATVLKKFIDHLLTKGASLDDIYM
IGVSLGAHISGFVGEEYNGKLGRITGLDPAGPLFNGKPPEDRLDPSDAQF
VDVIHSDIDALGYKEPLGNIDFYPNGGLDQPGCPKTIFGGMQYFKCDHQK
SVYLYLSSLRENCTVTAYPCDSYRDYRNGKCVSCGTPQTESCPLLGYFAD
NWKDYLTEKDPPMTKAYFDTAEEKPFCIYHYFVDIITWNKNIRRGSITIK
LKDKAGNTTESKIDHEPATFQKYHQVSLLARFSRDLDKVAAISLVFSTGS
VVGPRYKLRILRMKLRSLVHPERPQLCRYDLVLMENIETVFQPILCPKLQ
L


References
    Title: Genome analysis reveals insights into physiology and longevity of the Brandt's bat Myotis brandtii
    Seim I, Fang X, Xiong Z, Lobanov AV, Huang Z, Ma S, Feng Y, Turanov AA, Zhu Y and Gladyshev VN <19 more author(s)>
    Ref: Nat Commun, 4:2212, 2013 : PubMed

            

    Title: A high-resolution map of human evolutionary constraint using 29 mammals
    Lindblad-Toh K, Garber M, Zuk O, Lin MF, Parker BJ, Washietl S, Kheradpour P, Ernst J, Jordan G and Kellis M <76 more author(s)>
    Ref: Nature, 478:476, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer