Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pig-EST1

Sus scrofa (Pig) carboxylesterase retinyl ester hydrolase (EC 3.1.1.-) (reh) CES1

Comment
There are at least 6 isoenzyme (may be different genes Q9TS80 PLE1 A5A4F5 PLE3). Isoenzymes of pig-liver esterase reveal striking differences in enantioselectivities Hummel et al. 2007. Polyisoprenylated. methylated protein methyl esterase (PMPMEase). Pig liver esterase 5 (PLE5) (pig-a9gyw6) is the isoenzyme crystallized (5FV4)


Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Sus scrofa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Suina: N E > Suidae: N E > Sus: N E > Sus scrofa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





4 substrates (e.g. : Amoxicillin, Ampicillin, Monocaprin... more)
No inhibitor
Sequence
Graphical view for this peptide sequence: pig-EST1
Colored MSA for Carb_B_Chordata (raw)
MWLLPLVLTSLASSATWAGQPASPPVVDTAQGRVLGKYVSLEGLAQPVAV
FLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCCQDPVVEQMTSD
LFTNGKERLTLEFSEDCLYLNIYTPADLTKRGRLPVMVWIHGGGLVLGGA
PMYDGVVLAAHENVVVVAIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALH
WVQENIANFGGDPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGV
ALTVALVRKDMKAAAKQIAVLAGCKTTTSAVFVHCLRQKSEDELLDLTLK
MKFLTLDFHGDQRESHPFLPTVVDGVLLPKMPEEILAEKDFNTVPYIVGI
NKQEFGWLLPTMMGFPLSEGKLDQKTATSLLWKSYPIANIPEELTPVATD
KYLGGTDDPVKKKDLFLDLMGDVVFGVPSVTVARQHRDAGAPTYMYEFQY
RPSFSSDKKPKTVIGDHGDEIFSVFGFPLLKGDAPEEEVSLSKTVMKFWA
NFARSGNPNGEGLPHWPMYDQEEGYLQIGVNTQAAKRLKGEEVAFWNDLL
SKEAAKKPPKIKHAEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWLLPLVLTSLASSATWAGQPASPPVVDTAQGRVLGKYVSLEGLAQPVAV
FLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCCQDPVVEQMTSD
LFTNGKERLTLEFSEDCLYLNIYTPADLTKRGRLPVMVWIHGGGLVLGGA
PMYDGVVLAAHENVVVVAIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALH
WVQENIANFGGDPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGV
ALTVALVRKDMKAAAKQIAVLAGCKTTTSAVFVHCLRQKSEDELLDLTLK
MKFLTLDFHGDQRESHPFLPTVVDGVLLPKMPEEILAEKDFNTVPYIVGI
NKQEFGWLLPTMMGFPLSEGKLDQKTATSLLWKSYPIANIPEELTPVATD
KYLGGTDDPVKKKDLFLDLMGDVVFGVPSVTVARQHRDAGAPTYMYEFQY
RPSFSSDKKPKTVIGDHGDEIFSVFGFPLLKGDAPEEEVSLSKTVMKFWA
NFARSGNPNGEGLPHWPMYDQEEGYLQIGVNTQAAKRLKGEEVAFWNDLL
SKEAAKKPPKIKHAEL


References
16 more
    Title: Regioselective ester cleavage of di-(2-ethylhexyl) trimellitates by porcine liver esterase
    Hollerer C, Becker G, Goen T, Eckert E
    Ref: Toxicol In Vitro, 47:178, 2018 : PubMed

            

    Title: Liver prenylated methylated protein methyl esterase is the same enzyme as Sus scrofa carboxylesterase
    Oboh OT, Lamango NS
    Ref: J Biochem Mol Toxicol, 22:51, 2008 : PubMed

            

    Title: The nucleotide and deduced amino acid sequences of porcine liver proline- beta-naphthylamidase. Evidence for the identity with carboxylesterase
    Matsushima M, Inoue H, Ichinose M, Tsukada S, Miki K, Kurokawa K, Takahashi T, Takahashi K
    Ref: FEBS Letters, 293:37, 1991 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer