Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pseae-PA2934

Pseudomonas aeruginosa (strains PA01, PA2934 LESB58; 2192; UCBPP-PA14; C3719) the CFTR inhibitory factor Cif an epoxide hydrolase virulence factor

Relationship
Family|CFTR-inhibitory-factor_Cif
Block| X
Position in NCBI Life Tree|Pseudomonas aeruginosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas aeruginosa group: N E > Pseudomonas aeruginosa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
33 structures (e.g. : 3KD2, 3KDA, 3PI6... more)
No kinetic





12 substrates (e.g. : 1,2-epoxyoctane, 14,15-EET, 14,15-EpETE... more)
16 inhibitors (e.g. : 1,2-Cyclohexanediol, 1,2-Octanediol, 1,2-hexanediol... more)
>3 Genbank links 2 more: AE004719, FM209186, CH482384
1 Ncbi-nid : 9949021
1 Ncbi-pid : 9949029
>3 Structure links 30 more: 5JYC, 5HKA, 5HKB
1 UniProt : Q9HZR3
1 Interpro : Q9HZR3
1 Prodom : Q9HZR3
1 Pfam : Q9HZR3
1 PIRSF : Q9HZR3
1 SUPERFAM : Q9HZR3
Sequence
Graphical view for this peptide sequence: pseae-PA2934
Colored MSA for CFTR-inhibitory-factor_Cif (raw)
MILDRLCRGLLAGIALTFSLGGFAAEEFPVPNGFESAYREVDGVKLHYVK
GGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTG
YSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLV
YMEAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFL
EHFIKSHSSNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNA
ELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYADDVEGHVLPGCGHWLP
EECAAPMNRLVIDFLSRGR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MILDRLCRGLLAGIALTFSLGGFAAEEFPVPNGFESAYREVDGVKLHYVK
GGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTG
YSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLV
YMEAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFL
EHFIKSHSSNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNA
ELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYADDVEGHVLPGCGHWLP
EECAAPMNRLVIDFLSRGR


References
16 more
    Title: Pseudomonas aeruginosa sabotages the generation of host proresolving lipid mediators
    Flitter BA, Hvorecny KL, Ono E, Eddens T, Yang J, Kwak DH, Bahl CD, Hampton TH, Morisseau C and Bomberger JM <6 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 114:136, 2017 : PubMed

            

    Title: Visualizing the Mechanism of Epoxide Hydrolysis by the Bacterial Virulence Enzyme Cif
    Bahl CD, Hvorecny KL, Morisseau C, Gerber SA, Madden DR
    Ref: Biochemistry, 55:788, 2016 : PubMed

            

    Title: Signature motifs identify an acinetobacter cif virulence factor with epoxide hydrolase activity
    Bahl CD, Hvorecny KL, Bridges AA, Ballok AE, Bomberger JM, Cady KC, O'Toole GA, Madden DR
    Ref: Journal of Biological Chemistry, 289:7460, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer