Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psepk-q88qt0

Pseudomonas putida Putative uncharacterized protein

Comment
Other strains: Pseudomonas putida (KT2440; BIRD-1; F1 / ATCC 700007)


Relationship
Family|Duf_3530
Block| X
Position in NCBI Life Tree|Pseudomonas putida
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas putida group: N E > Pseudomonas putida: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AE015451, CP002290, CP000712
2 UniProt : Q88QT0, A5VXK2
2 UniProt : Q88QT0, A5VXK2
2 Interpro : Q88QT0, A5VXK2
2 Pfam : Q88QT0, A5VXK2
2 PIRSF : Q88QT0, A5VXK2
2 SUPERFAM : Q88QT0, A5VXK2
Sequence
Graphical view for this peptide sequence: psepk-q88qt0
Colored MSA for Duf_3530 (raw)
MSTLYRTTLAMCCLASVLPLGALAADAEKPPANAMAPAAEAPRPPLLERS
QEDALALERLLPKAEQQTLQAGADSFLALWKPANDNDPQGAVIIVPGAGE
TADWPNAVGPLRQKFPDIGWHSLSVSLPDLLADSPQARVEATPPAAPAPD
KGESAPAKDVPADANANVAQATAADADTAESTDAEQASEQADPADAERIF
ARLDAAVAFAQQHNARSIVLIGHGSGAYWAARYLSEKQPPQVQKLVMVAA
QTPARVEQDLESLAPTLKVPTADIYYATRSADRNAAQQRLQASKRQKDSQ
YRQLSLIAMPANKAAEQEQLFRRVRGWMSPQG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSTLYRTTLAMCCLASVLPLGALAADAEKPPANAMAPAAEAPRPPLLERS
QEDALALERLLPKAEQQTLQAGADSFLALWKPANDNDPQGAVIIVPGAGE
TADWPNAVGPLRQKFPDIGWHSLSVSLPDLLADSPQARVEATPPAAPAPD
KGESAPAKDVPADANANVAQATAADADTAESTDAEQASEQADPADAERIF
ARLDAAVAFAQQHNARSIVLIGHGSGAYWAARYLSEKQPPQVQKLVMVAA
QTPARVEQDLESLAPTLKVPTADIYYATRSADRNAAQQRLQASKRQKDSQ
YRQLSLIAMPANKAAEQEQLFRRVRGWMSPQG


References
    Title: Complete genome of the plant growth-promoting rhizobacterium Pseudomonas putida BIRD-1
    Matilla MA, Pizarro-Tobias P, Roca A, Fernandez M, Duque E, Molina L, Wu X, van der Lelie D, Gomez MJ and Ramos JL <1 more author(s)>
    Ref: Journal of Bacteriology, 193:1290, 2011 : PubMed

            

    Title: Complete genome sequence and comparative analysis of the metabolically versatile Pseudomonas putida KT2440
    Nelson KE, Weinel C, Paulsen IT, Dodson RJ, Hilbert H, Martins dos Santos VA, Fouts DE, Gill SR, Pop M and Fraser CM <33 more author(s)>
    Ref: Environ Microbiol, 4:799, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer