Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: thema-TM0077

Thermotoga maritima, Thermotoga naphthophila, Thermotoga petrophila, Thermotoga neapolitana, acetyl xylan esterase (TM0077) (axeA) CE7

Comment
Other strains: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) Thermotoga sp. (strain RQ2), Thermotoga naphthophila (strains ATCC BAA-489 / DSM 13996 / JCM 10882 / RKU-10; RKU-1 / ATCC BAA-488 / DSM 13995) Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995), Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) TM0077 from Thermotoga maritima belongs to the carbohydrate esterase family 7 and is active on a variety of acetylated compounds, including cephalosporin C. TM0077 is an acetyl esterase and not an acetyl xylan esterase


Relationship
Family|Acetyl-esterase_deacetylase
Block| X
Position in NCBI Life Tree|Thermotoga maritima
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Thermotogae [phylum]: N E > Thermotogae [class]: N E > Thermotogales: N E > Thermotogaceae: N E > Thermotoga: N E > Thermotoga maritima: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
8 structures (e.g. : 1VLQ, 3M81, 3M82... more)
No kinetic





4 substrates (e.g. : 2-indolinone-3-acetate, 4-methylumbelliferyl-acetate, 7-Aminocephalosporanic-acid... more)
2 inhibitors: PMSF, Paraoxon
>3 Genbank links 3 more: AE001694, CP000969, CP001839
>3 UniProt links 2 more: D2C766, A5IKZ3, O33842
2 Ncbi-nid : 4980558, 2429091
2 Ncbi-pid : 4980565, 2429094
>3 Structure links 5 more: 5GMA, 5JIB, 5FDF
>3 UniProt links 2 more: Q9WXT2, D2C766, A5IKZ3
>3 Interpro links 2 more: Q9WXT2, D2C766, A5IKZ3
>3 Pfam links 2 more: Q9WXT2, D2C766, A5IKZ3
>3 PIRSF links 2 more: Q9WXT2, D2C766, A5IKZ3
>3 SUPERFAM links 2 more: Q9WXT2, D2C766, A5IKZ3
Sequence
Graphical view for this peptide sequence: thema-TM0077
Colored MSA for Acetyl-esterase_deacetylase (raw)
MAFFDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESH
LKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPH
DWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPEGPVDPQYPGFMTRGIL
DPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSAL
SKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTL
SYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPY
NNHEGGGSFQAVEQVKFLKKLFEKG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAFFDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESH
LKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPH
DWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPEGPVDPQYPGFMTRGIL
DPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSAL
SKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTL
SYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPY
NNHEGGGSFQAVEQVKFLKKLFEKG


References
5 more
    Title: Structural role of a conserved active site cis proline in the Thermotoga maritima acetyl esterase from the carbohydrate esterase family 7
    Singh MK, Manoj N
    Ref: Proteins, 85:694, 2017 : PubMed

            

    Title: Role of an N-terminal extension in stability and catalytic activity of a hyperthermostable alpha/beta hydrolase fold esterase
    Singh MK, Shivakumaraswamy S, Gummadi SN, Manoj N
    Ref: Protein Engineering Des Sel, 30:559, 2017 : PubMed

            

    Title: Crystal structure of Thermotoga maritima acetyl esterase complex with a substrate analog: Insights into the distinctive substrate specificity in the CE7 carbohydrate esterase family
    Singh MK, Manoj N
    Ref: Biochemical & Biophysical Research Communications, 476:63, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer