Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: xanau-halo1

Xanthobacter autotrophicus, Xanthobacter flavus, Ancylobacter aquaticus, haloalkane dehalogenase DhlA

Comment
Other strains: Xanthobacter autotrophicus GJ10, Xanthobacter flavus; Ancylobacter aquaticus Q6Q3H0 AY561847 for Xanthobacter flavus identical


Relationship
Family|Haloalkane_dehalogenase-HLD1
Block| X
Position in NCBI Life Tree|Xanthobacter autotrophicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Xanthobacteraceae: N E > Xanthobacter: N E > Xanthobacter autotrophicus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
17 structures (e.g. : 1B6G, 1BE0, 1BEE... more)
No kinetic





28 substrates (e.g. : (Bromomethyl)cylcohexane, 1,2,3-Tribromopropane, 1,2-Dibromo-3-Chloropropane... more)
No inhibitor
>3 Genbank links 4 more: M26950, AY561847, FJ573162
3 UniProt : P22643, Q6Q3H0, B8YPW8
1 Ncbi-nid : 155347
1 Ncbi-pid : 155348
>3 Structure links 14 more: 1EDB, 1EDD, 1EDE
3 UniProt : P22643, Q6Q3H0, B8YPW8
3 Interpro : P22643, Q6Q3H0, B8YPW8
3 Pfam : P22643, Q6Q3H0, B8YPW8
3 PIRSF : P22643, Q6Q3H0, B8YPW8
3 SUPERFAM : P22643, Q6Q3H0, B8YPW8
Sequence
Graphical view for this peptide sequence: xanau-halo1
Colored MSA for Haloalkane_dehalogenase-HLD1 (raw)
MINAIRTPDQRFSNLDQYPFSPNYLDDLPGYPGLRAHYLDEGNSDAEDVF
LCLHGEPTWSYLYRKMIPVFAESGARVIAPDFFGFGKSDKPVDEEDYTFE
FHRNFLLALIERLDLRNITLVVQDWGGFLGLTLPMADPSRFKRLIIMNAC
LMTDPVTQPAFSAFVTQPADGFTAWKYDLVTPSDLRLDQFMKRWAPTLTE
AEASAYAAPFPDTSYQAGVRKFPKMVAQRDQACIDISTEAISFWQNDWNG
QTFMAIGMKDKLLGPDVMYPMKALINGCPEPLEIADAGHFVQEFGEQVAR
EALKHFAETE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MINAIRTPDQRFSNLDQYPFSPNYLDDLPGYPGLRAHYLDEGNSDAEDVF
LCLHGEPTWSYLYRKMIPVFAESGARVIAPDFFGFGKSDKPVDEEDYTFE
FHRNFLLALIERLDLRNITLVVQDWGGFLGLTLPMADPSRFKRLIIMNAC
LMTDPVTQPAFSAFVTQPADGFTAWKYDLVTPSDLRLDQFMKRWAPTLTE
AEASAYAAPFPDTSYQAGVRKFPKMVAQRDQACIDISTEAISFWQNDWNG
QTFMAIGMKDKLLGPDVMYPMKALINGCPEPLEIADAGHFVQEFGEQVAR
EALKHFAETE


References
20 more
    Title: One-step orientated immobilization of nanobodies and its application for immunoglobulin purification
    Fu J, Li J, Wang W, Wu H, Zhou P, Li Y, He Q, Tu Z
    Ref: Journal of Chromatography A, 1603:15, 2019 : PubMed

            

    Title: Exploring the challenges of computational enzyme design by rebuilding the active site of a dehalogenase
    Jindal G, Slanska K, Kolev V, Damborsky J, Prokop Z, Warshel A
    Ref: Proc Natl Acad Sci U S A, 116:389, 2019 : PubMed

            

    Title: Bacillus subtilis Spore Surface Display of Haloalkane Dehalogenase DhaA
    Wang F, Song T, Jiang H, Pei C, Huang Q, Xi H
    Ref: Curr Microbiol, 76:1161, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer