Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: xanax-XAC3037

Xanthomonas axonopodis (pv. citri) and Xanthomonas campestris pv. vesicatoria (strain 85-10) hydrolase

Relationship
Family|AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Xanthomonas axonopodis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Xanthomonadales: N E > Xanthomonadaceae: N E > Xanthomonas: N E > Xanthomonas axonopodis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AE011946, AM039952
1 UniProt : Q3BQQ8
2 UniProt : Q8PI61, Q3BQQ8
2 Interpro : Q8PI61, Q3BQQ8
2 Pfam : Q8PI61, Q3BQQ8
2 PIRSF : Q8PI61, Q3BQQ8
2 SUPERFAM : Q8PI61, Q3BQQ8
Sequence
Graphical view for this peptide sequence: xanax-XAC3037
Colored MSA for AlphaBeta_hydrolase (raw)
MEITMRKRVCTLMLGLASSPLLAQEASYGPRLEGFDYPHPVKTYAFTSQQ
QPLEMAYLDVAPTGTPNGHTAVLLHGKNFCAATWEDSIAALSKAGYRVIA
PDQIGFCKSSKPAAYQFSFAQLADNTHALLKTLGIERAVVVGHSMGGMLA
IRYALMYPQATEHLALVDPIGLEDWKAEGIPWRSVDAWYDNEMKISFERI
KKYQMDVYYAGQWKPEFERWARMQAGMSLGKGKQAVAWNQALTYDMVFNQ
PVVYELPKLAVPTTLFIGLKDRTAIGKDTAPPQVKARVGDYTKLGKRAAA
AIPNAKLIEFADLGHSPQVQDPARFNAALLKAIAQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEITMRKRVCTLMLGLASSPLLAQEASYGPRLEGFDYPHPVKTYAFTSQQ
QPLEMAYLDVAPTGTPNGHTAVLLHGKNFCAATWEDSIAALSKAGYRVIA
PDQIGFCKSSKPAAYQFSFAQLADNTHALLKTLGIERAVVVGHSMGGMLA
IRYALMYPQATEHLALVDPIGLEDWKAEGIPWRSVDAWYDNEMKISFERI
KKYQMDVYYAGQWKPEFERWARMQAGMSLGKGKQAVAWNQALTYDMVFNQ
PVVYELPKLAVPTTLFIGLKDRTAIGKDTAPPQVKARVGDYTKLGKRAAA
AIPNAKLIEFADLGHSPQVQDPARFNAALLKAIAQ


References
    Title: Insights into genome plasticity and pathogenicity of the plant pathogenic bacterium Xanthomonas campestris pv. vesicatoria revealed by the complete genome sequence
    Thieme F, Koebnik R, Bekel T, Berger C, Boch J, Buttner D, Caldana C, Gaigalat L, Goesmann A and Kaiser O <19 more author(s)>
    Ref: Journal of Bacteriology, 187:7254, 2005 : PubMed

            

    Title: Comparison of the genomes of two Xanthomonas pathogens with differing host specificities
    da Silva ACR, Ferro JA, Reinach FC, Farah CS, Furlan LR, Quaggio RB, Monteiro-Vitorello CB, Van Sluys MA, Almeida Jr NF and Kitajima JP <55 more author(s)>
    Ref: Nature, 417:459, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer