Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-ATG15

CDS from: Saccharomyces cerevisiae (and strain YJM789) lipase involved in lipid vesicles degradation YCR068W Cytoplasm to vacuole targeting protein 17 ATG15

Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: 10383748, AJ414729, X59720
2 UniProt : P25641, A6ZTP2
1 Ncbi-pid : 10383802
2 UniProt : P25641, A6ZTP2
2 Interpro : P25641, A6ZTP2
2 Prodom : P25641, A6ZTP2
2 Pfam : P25641, A6ZTP2
2 PIRSF : P25641, A6ZTP2
2 SUPERFAM : P25641, A6ZTP2
1 SGD : S0000664
Sequence
Graphical view for this peptide sequence: yeast-ATG15
Colored MSA for Lipase_3 (raw)
MLHKSPSRKRFASPLHLGCILTLTVLCLIAYYFALPDYLSVGKSSSRGAM
DQKSDGTFRLKSIYRHGVGANHRLHQRLEVTPEVISAAGMLYQETTTQGQ
DFEDQEPLWTTNAEYATTNPFDFEFELRRMPLLMKRMKERDPEFIESYIY
GETYMTEEEEHAMWIDDDIVAPNITDRGTVVSLALMSSNAYVRIPQTGDW
RNVTEPWNETEPEDFGWDGDGIRGHVFYNEVENIVVLSIKGTSAQGLPGS
GEDETTGNDKINDNLLFSCCCARVSYLWTTVCDCYVKSYICDESCLEKEL
RRKDRFYSAVVDIYKGVLKEYPDAAIWVTGHSLGGALASLLGRTFGLPAV
AFESPGELLPSKRLHLPFPPGLPSYMEGIWHFGHNADPIFMGTCNGASSS
CSLVGYAMETACHTGRVCVYDVVNDKGWSVNMFNHRIHKVIDEVLLGYEQ
AAKCVEPEPCVDCYNWKFIPSRDWESSSRLITKTKSHAAPTTTTRTTATT
TSSSTCVGRNWLGFCTKYEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLHKSPSRKRFASPLHLGCILTLTVLCLIAYYFALPDYLSVGKSSSRGAM
DQKSDGTFRLKSIYRHGVGANHRLHQRLEVTPEVISAAGMLYQETTTQGQ
DFEDQEPLWTTNAEYATTNPFDFEFELRRMPLLMKRMKERDPEFIESYIY
GETYMTEEEEHAMWIDDDIVAPNITDRGTVVSLALMSSNAYVRIPQTGDW
RNVTEPWNETEPEDFGWDGDGIRGHVFYNEVENIVVLSIKGTSAQGLPGS
GEDETTGNDKINDNLLFSCCCARVSYLWTTVCDCYVKSYICDESCLEKEL
RRKDRFYSAVVDIYKGVLKEYPDAAIWVTGHSLGGALASLLGRTFGLPAV
AFESPGELLPSKRLHLPFPPGLPSYMEGIWHFGHNADPIFMGTCNGASSS
CSLVGYAMETACHTGRVCVYDVVNDKGWSVNMFNHRIHKVIDEVLLGYEQ
AAKCVEPEPCVDCYNWKFIPSRDWESSSRLITKTKSHAAPTTTTRTTATT
TSSSTCVGRNWLGFCTKYEL


References
6 more
    Title: Atg15 in Saccharomyces cerevisiae consists of two functionally distinct domains
    Hirata E, Shirai K, Kawaoka T, Sato K, Kodama F, Suzuki K
    Ref: Mol Biology of the cell, :mbcE20070500, 2021 : PubMed

            

    Title: Life with 6000 genes
    Goffeau A, Barrell BG, Bussey H, Davis RW, Dujon B, Feldmann H, Galibert F, Hoheisel JD, Jacq C and Oliver SG <6 more author(s)>
    Ref: Science, 274:546, 1996 : PubMed

            

    Title: The complete DNA sequence of yeast chromosome III
    Oliver SG, van der Aart QJ, Agostoni-Carbone ML, Aigle M, Alberghina L, Alexandraki D, Antoine G, Anwar R, Ballesta JP and et al. <1 more author(s)>
    Ref: Nature, 357:38, 1992 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer