Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-k0c6t6

Cycloclasticus sp. P1, EH60 Alpha/beta hydrolase fold-containing protein CCSP0084

Comment
EH60 promiscuous activity 21/96 substrates Martinez-Martinez et al. 2018


Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Cycloclasticus sp. P1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Thiotrichales: N E > Piscirickettsiaceae: N E > Cycloclasticus: N E > Cycloclasticus sp. P1: N E


Molecular evidence
Database
No mutation
1 structure:
4I3F: Crystal structure of serine hydrolase CCSP0084 from the polyaromatic hydrocarbon (PAH)-degrading bacterium Cycloclasticus zankles
No kinetic





No Substrate
No inhibitor
1 Genbank : CP003230
1 UniProt : K0C6T6
1 Structure : 4I3F
1 UniProt : K0C6T6
1 Interpro : K0C6T6
1 Prodom : K0C6T6
1 Pfam : K0C6T6
1 PIRSF : K0C6T6
1 SUPERFAM : K0C6T6
Sequence
Graphical view for this peptide sequence: 9gamm-k0c6t6
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MQTSNIQTGSFNTFLNEAGTDKDTSILLLHGSGPGANAMSNWQYALPFLA
ENYHCLAPDIAGFGLSQHNCPPNGTSHWIDIWVQQQIDLLDAKGIEQTHI
VGNSMGGGVTLHLLNRHPERFKKAVLMGPVGAPFAPTEGLTKGWEFYKDP
SKEALEYLITKFLFDPSLLGNDIASIAAQRFDNVMKDEVRLQFEAMFSGG
TKKGIDAFVLSDDELNNISHQMLVTHAREDFFIPLNNAYHLIDRIPNAQL
HVFDHCGHWIQIEKKKAFNNLTKLFFDGMFDD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQTSNIQTGSFNTFLNEAGTDKDTSILLLHGSGPGANAMSNWQYALPFLA
ENYHCLAPDIAGFGLSQHNCPPNGTSHWIDIWVQQQIDLLDAKGIEQTHI
VGNSMGGGVTLHLLNRHPERFKKAVLMGPVGAPFAPTEGLTKGWEFYKDP
SKEALEYLITKFLFDPSLLGNDIASIAAQRFDNVMKDEVRLQFEAMFSGG
TKKGIDAFVLSDDELNNISHQMLVTHAREDFFIPLNNAYHLIDRIPNAQL
HVFDHCGHWIQIEKKKAFNNLTKLFFDGMFDD


References
    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            

    Title: Single residues dictate the co-evolution of dual esterases: MCP hydrolases from the alpha/beta hydrolase family
    Alcaide M, Tornes J, Stogios PJ, Xu X, Gertler C, Di Leo R, Bargiela R, Lafraya A, Guazzaroni ME and Ferrer M <9 more author(s)>
    Ref: Biochemical Journal, 454:157, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer