arath-SCP26

 
Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress), F11F19.31 AT2G35780 SCPL26, Serine carboxypeptidase-like 26

Comment
Other strains: Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. petraea (Northern rock-cress) (Cardaminopsis petraea), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)


Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : AC007017
3 UniProt : B1PBY9, Q9ZQQ0, D7LIK6
3 UniProtTrembl : Q9ZQQ0, B1PBY9, D7LIK6
3 Interpro : Q9ZQQ0, B1PBY9, D7LIK6
3 Prodom : Q9ZQQ0, B1PBY9, D7LIK6
3 Pfam : Q9ZQQ0, B1PBY9, D7LIK6
3 PIRSF : Q9ZQQ0, B1PBY9, D7LIK6
3 SUPERFAM : Q9ZQQ0, B1PBY9, D7LIK6
3 QuickSwissBlast : Q9ZQQ0, B1PBY9, D7LIK6
1 Tair database : At2g35780
 
Sequence
Graphical view for this peptide sequence: arath-SCP26
Colored MSA for Carboxypeptidase_S10 (raw)
MARLLLLFFFFLILLHYASCSRHEQEKDRIFHLPGEPNDVSFSHFSGYIT
VNESAGRALFYWLTESPPSENPESKPLVLWLNGGPGCSSVAYGAAEEIGP
FRINPDGKTLYHNPYSWNKLANLLFLESPAGVGFSYSNTTSDLYTAGDQR
TAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYVPQLSQIVYEKRNPA
INFKGFIVGNAVIDDYHDYVGLFEYWWAHGLISDLTYHNLRITCEFGSSE
HPSSKCTKAMEAADLEQGNIDPYSIYTVTCKKEAAALRSRFSRVRHPWMW
RAYDPCTEKYSGMYFNSPEVQKAMHANITGLAYPWKGCSDIVGEKWADSP
LSMLPIYKELIAAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPLSKWYP
WNDDGQVGGWSQVYKGLTLVTIHGAGHEVPLFRPRRAFLLFQSFLDNKPL
PM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MARLLLLFFFFLILLHYASCSRHEQEKDRIFHLPGEPNDVSFSHFSGYIT
VNESAGRALFYWLTESPPSENPESKPLVLWLNGGPGCSSVAYGAAEEIGP
FRINPDGKTLYHNPYSWNKLANLLFLESPAGVGFSYSNTTSDLYTAGDQR
TAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYVPQLSQIVYEKRNPA
INFKGFIVGNAVIDDYHDYVGLFEYWWAHGLISDLTYHNLRITCEFGSSE
HPSSKCTKAMEAADLEQGNIDPYSIYTVTCKKEAAALRSRFSRVRHPWMW
RAYDPCTEKYSGMYFNSPEVQKAMHANITGLAYPWKGCSDIVGEKWADSP
LSMLPIYKELIAAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPLSKWYP
WNDDGQVGGWSQVYKGLTLVTIHGAGHEVPLFRPRRAFLLFQSFLDNKPL
PM

no DNA




References
1 more
    Title: The shrunken genome of Arabidopsis thaliana.
    Oyama RK, Clauss MJ, Formanova N, Kroymann J, Schmid KJ, Vogel H, Weniger K, Windsor AJ, Mitchell-Olds T
    Ref: Plant Syst Evol, 273:257, 2008 : PubMed

            

    Title: An expression and bioinformatics analysis of the Arabidopsis serine carboxypeptidase-like gene family
    Fraser CM, Rider LW, Chapple C
    Ref: Plant Physiol, 138:1136, 2005 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer