Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-q66gm8

Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) subsp. petraea (Northern rock-cress) (Cardaminopsis petraea) At5g26670 F21E10.11 AtPAE10

Relationship
Family|Pectinacetylesterase-Notum
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: BT015374, AF058914, AK317140
1 UniProt : Q66GM8
3 UniProt : Q66GM8, D7M5B5, B1PBZ1
3 Interpro : Q66GM8, D7M5B5, B1PBZ1
3 Prodom : Q66GM8, D7M5B5, B1PBZ1
3 Pfam : Q66GM8, D7M5B5, B1PBZ1
3 PIRSF : Q66GM8, D7M5B5, B1PBZ1
3 SUPERFAM : Q66GM8, D7M5B5, B1PBZ1
1 Tair database : At5g26670
Sequence
Graphical view for this peptide sequence: arath-q66gm8
Colored MSA for Pectinacetylesterase-Notum (raw)
MRKLFLLGFIVAGLVLGNEANGYLEFNVTELDRIEDLEFGFSKFSSNFNP
LMVGLTLIRGAGSKGAVCLDGTLPGYHLHRGHGSGANSWLIQLEGGGWCD
NIRNCVYRKKSRRGSSNYMEKQIQFTGILSNKAQENPDFFNWNRVKLRYC
DGGSFSGDSQNKAARLQFRGEKIWRAAMDDLKAKGMRNAKQALLSGCSAG
GLAVILRCDEFRNLFSGWTRVKCLSDAGLFLDTPDVSGGHTIRNLYNGVV
QLQGVKNNLPHLCTNHLNPTSCFFPQNLISQMKTPLFIVNAAYDIWQIQS
SIAPPSADPSGYWHECRLNHGRCTPAQIRFLQGFRNQMLRAVSGFSNSKK
NGLFINSCFAHCQTERQDTWFADDSPVIHKKAVAIAVGDWYFDRAEVKLI
DCPYPCDRSCHNLVFR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRKLFLLGFIVAGLVLGNEANGYLEFNVTELDRIEDLEFGFSKFSSNFNP
LMVGLTLIRGAGSKGAVCLDGTLPGYHLHRGHGSGANSWLIQLEGGGWCD
NIRNCVYRKKSRRGSSNYMEKQIQFTGILSNKAQENPDFFNWNRVKLRYC
DGGSFSGDSQNKAARLQFRGEKIWRAAMDDLKAKGMRNAKQALLSGCSAG
GLAVILRCDEFRNLFSGWTRVKCLSDAGLFLDTPDVSGGHTIRNLYNGVV
QLQGVKNNLPHLCTNHLNPTSCFFPQNLISQMKTPLFIVNAAYDIWQIQS
SIAPPSADPSGYWHECRLNHGRCTPAQIRFLQGFRNQMLRAVSGFSNSKK
NGLFINSCFAHCQTERQDTWFADDSPVIHKKAVAIAVGDWYFDRAEVKLI
DCPYPCDRSCHNLVFR


References
1 more
    Title: Plant pectin acetylesterase structure and function: new insights from bioinformatic analysis
    Philippe F, Pelloux J, Rayon C
    Ref: BMC Genomics, 18:456, 2017 : PubMed

            

    Title: Analysis of multiple occurrences of alternative splicing events in Arabidopsis thaliana using novel sequenced full-length cDNAs
    Iida K, Fukami-Kobayashi K, Toyoda A, Sakaki Y, Kobayashi M, Seki M, Shinozaki K
    Ref: DNA Research, 16:155, 2009 : PubMed

            

    Title: Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana
    Tabata S, Kaneko T, Nakamura Y, Kotani H, Kato T, Asamizu E, Miyajima N, Sasamoto S, Kimura T and Fransz P <119 more author(s)>
    Ref: Nature, 408:823, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer