aspfu-CBPYA

 
Aspergillus fumigatus (Sartorya fumigata) Neosartorya fumigata (Aspergillus fischerianus), carboxypeptidase 3

Comment
Other strains: Neosartorya fumigata (strains CEA10 / CBS 144.89 / FGSC A1163; ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus),Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) (Aspergillus fischerianus)


Relationship
Block X
Aspergillus fumigatus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fumigatus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : AY436353, AAHF01000006
3 UniProt : Q5VJG9, A1DP75, B0XM76
3 UniProtTrembl : Q5VJG9, A1DP75, B0XM76
3 Interpro : Q5VJG9, A1DP75, B0XM76
3 Prodom : Q5VJG9, A1DP75, B0XM76
3 Pfam : Q5VJG9, A1DP75, B0XM76
3 PIRSF : Q5VJG9, A1DP75, B0XM76
3 SUPERFAM : Q5VJG9, A1DP75, B0XM76
3 QuickSwissBlast : Q5VJG9, A1DP75, B0XM76
 
Sequence
Graphical view for this peptide sequence: aspfu-CBPYA
Colored MSA for Carboxypeptidase_S10 (raw)
MRVLPATLLVGAATAAAPPFQQILGLPKKSADTLAKPLHDLQEQLKTLSG
EARHLWDEVASHFPNNMDHNPVFSLPKKHTRRPDSHWDHIVRGADVQSVW
VAGASGEKEREIDGKLEAYDLRVKKTDPSALGIDPGVKQYTGYLDDNEND
KHLFYWFFESRNDPKNDPVVLWLNGGPGCSSLTGLFLELGPSSINEKIKP
IYNDFAWNSNASVIFLDQPVNVGYSYSGAAVSDTVAAGKDVYALLTLFFK
QFPEYAKQDFHIAGESYAGHYIPVFASEILSHKKRNINLKSVLIGNGLTD
GLTQYDYYRPMACGEGGYPAVLDESSCQSMDNALPRCKSMIESCYNTESS
WICVPASIYCNNALLGPYQRTGQNVYDIRGKCEDSSNLCYKGMGYVSEYL
NKREVREAVGAEVDGYESCNFDINRNFLFHGDWMKPYHRLVPGLLEQIPV
LIYAGDADFICNWLGNKAWTEALEWPGQKEYAPLPLKDLVIEENEHKGKK
IGQIKSHGNFTFMRLYGAGHMVPMDQPEASLEFFNRWLGGEWF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRVLPATLLVGAATAAAPPFQQILGLPKKSADTLAKPLHDLQEQLKTLSG
EARHLWDEVASHFPNNMDHNPVFSLPKKHTRRPDSHWDHIVRGADVQSVW
VAGASGEKEREIDGKLEAYDLRVKKTDPSALGIDPGVKQYTGYLDDNEND
KHLFYWFFESRNDPKNDPVVLWLNGGPGCSSLTGLFLELGPSSINEKIKP
IYNDFAWNSNASVIFLDQPVNVGYSYSGAAVSDTVAAGKDVYALLTLFFK
QFPEYAKQDFHIAGESYAGHYIPVFASEILSHKKRNINLKSVLIGNGLTD
GLTQYDYYRPMACGEGGYPAVLDESSCQSMDNALPRCKSMIESCYNTESS
WICVPASIYCNNALLGPYQRTGQNVYDIRGKCEDSSNLCYKGMGYVSEYL
NKREVREAVGAEVDGYESCNFDINRNFLFHGDWMKPYHRLVPGLLEQIPV
LIYAGDADFICNWLGNKAWTEALEWPGQKEYAPLPLKDLVIEENEHKGKK
IGQIKSHGNFTFMRLYGAGHMVPMDQPEASLEFFNRWLGGEWF

no DNA




Reference
    Title: Genomic sequence of the pathogenic and allergenic filamentous fungus Aspergillus fumigatus
    Nierman WC, Pain A, Anderson MJ, Wortman JR, Kim HS, Arroyo J, Berriman M, Abe K, Archer DB and Denning DW <87 more author(s)>
    Ref: Nature, 438:1151, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer