Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: betvv-a0a0j8b442

Beta vulgaris subsp. vulgaris (Beet). Lipase_3 domain-containing protein

Relationship
Family|Triacylglycerol-lipase-OBL1-like
Block| L
Position in NCBI Life Tree|Beta vulgaris subsp. vulgaris
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > Caryophyllales: N E > Chenopodiaceae: N E > Betoideae: N E > Beta: N E > Beta vulgaris: N E > Beta vulgaris subsp. vulgaris: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KQ090420
1 UniProt : A0A0J8B442
1 UniProt : A0A0J8B442
1 Interpro : A0A0J8B442
1 Pfam : A0A0J8B442
1 PIRSF : A0A0J8B442
1 SUPERFAM : A0A0J8B442
Sequence
Graphical view for this peptide sequence: betvv-a0a0j8b442
Colored MSA for Triacylglycerol-lipase-OBL1-like (raw)
MATNELASCNHVNLLPDKNKATFRNFFKNLCFNRHISETELLDHNCYEDE
EIKILHRGMIFLSMFIQISLKHMSKPMKICRSFIEGFLNRGVTQRESVKY
YSFLGHSDYRLDLSKDIKHEDARYYPALTVMASKLSYENKAVIRTAVTDH
WKMEFVDFYNFYNEYQRKLTTQAFIFRERNADGDRIIVAFRGTSPFVADD
WSTDFDFSWLKIGGMGKTHMGFMIALGLQKFSREDDDYYGDFSGSWPKEV
DQHPQQPLAYYTIREKLKELLGDDKNAKIIVTGHSLGGALAILFPAVLAF
HGEVELLNRLEGIYTYGQPRVGDREFGEFMKKNLREHKIKYYRIVYNYDL
VTKVPLDDALMTFKHFGKCIVFNSLYHGKVVKEEEERSGNIILRIMKLII
VTLFNFIVARLTAVWELIRGFFIGLVKGPEYKEGWMLTFLRVTGIFLPSI
VNHFPQDYVNSTRLASEDLFKVCPALL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MATNELASCNHVNLLPDKNKATFRNFFKNLCFNRHISETELLDHNCYEDE
EIKILHRGMIFLSMFIQISLKHMSKPMKICRSFIEGFLNRGVTQRESVKY
YSFLGHSDYRLDLSKDIKHEDARYYPALTVMASKLSYENKAVIRTAVTDH
WKMEFVDFYNFYNEYQRKLTTQAFIFRERNADGDRIIVAFRGTSPFVADD
WSTDFDFSWLKIGGMGKTHMGFMIALGLQKFSREDDDYYGDFSGSWPKEV
DQHPQQPLAYYTIREKLKELLGDDKNAKIIVTGHSLGGALAILFPAVLAF
HGEVELLNRLEGIYTYGQPRVGDREFGEFMKKNLREHKIKYYRIVYNYDL
VTKVPLDDALMTFKHFGKCIVFNSLYHGKVVKEEEERSGNIILRIMKLII
VTLFNFIVARLTAVWELIRGFFIGLVKGPEYKEGWMLTFLRVTGIFLPSI
VNHFPQDYVNSTRLASEDLFKVCPALL


Reference
    Title: The genome of the recently domesticated crop plant sugar beet (Beta vulgaris)
    Dohm JC, Minoche AE, Holtgrawe D, Capella-Gutierrez S, Zakrzewski F, Tafer H, Rupp O, Sorensen TR, Stracke R and Himmelbauer H <9 more author(s)>
    Ref: Nature, 505:546, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer