Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brume-BMEII0681

Brucella melitensis, Brucella abortus, Brucella suis, B. canis, B. sp., B. neotomae, B. inopinata, B. ovis, B. microti, B. ceti, B. pinnipedialis, virulence protein

Comment
Brucella melitensis (strains M5-90; biotypes 1 (16M / ATCC 23456 / NCTC 10094; Rev.1) 2 (63/9; ATCC 23457) 3 Ether, M28), Brucella abortus (strains S19; NCTC 8038; 2308; A 8038; biotypes: 2 86/8/59; 3 str. Tulya; 4 str. 292; 5 str. B3196; 6 str. 870; 9 str. C68), Brucella suis (biotypes: 3 str. 686; 4 str. 40; 5 str. 513; 1 (strain 1330); ATCC 23445 / NCTC 10510), Brucella canis (strain ATCC 23365 / NCTC 10854), Brucella sp. (83/13; NVSL 07-0026; BO2; NF 2653; F5/99), Brucella neotomae 5K33, Brucella inopinata BO1, Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512; IntaBari-2002-82-58), Brucella microti (strain CCM 4915), Brucella ceti (M490/95/1, M644/93/1, B1/94, M13/05/1; Cudo), Brucella pinnipedialis (M163/99/10, M292/94/1, B2/94); Brucella melitensis; Brucella pinnipedialis M292/94/1; Brucella sp.(strain S19, strain ATCC 25840 / 63/290 / NCTC 10512, strain 1330)


Relationship
Family|VirJ
Block| X
Position in NCBI Life Tree|Brucella melitensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Brucellaceae: N E > Brucella: N E > Brucella melitensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: brume-BMEII0681
Colored MSA for VirJ (raw)
MKKERVFFIVLGLALVCAAGIYASLHSGKIARFWAQLYNADEPVIHASAE
RLSNIPVYMPKGDPVGLAILLSDEKGIGDQERSYMDAMLARNIIVMPVEL
GPWRAALDKEDGECNYLDSDFEAIAKEALRGLDLGVYFHPVLTGIGQGAT
IAYAAASDSPDATIAGAVSLDPTPARTRLPSCTEKAEAIKGPDGGFTYSV
NAALPAPALLISPPGSPVNNPVEARRKNIAVLQTAPDFSARMKMAVDNVV
AMADQDAKNEALPIIDLPAKGGNADMVAVFYSGDGGWRDIDKSIGEWLQA
HGVHVIGVDSLRYFWSERTPEEIANDTTAMIKKADPTGKLPVAVLGYSFG
ADTFPFAWKYLDPSIQDRTRMVGLLGVETTTTFQVSIEGWLGMNGDKDVV
PAIASIPLDRVVCVYGQEEDDTACTADELKGMDTIKLPGGHHFDENYEPI
AAALLDKMRSRAGLPPRPAR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKERVFFIVLGLALVCAAGIYASLHSGKIARFWAQLYNADEPVIHASAE
RLSNIPVYMPKGDPVGLAILLSDEKGIGDQERSYMDAMLARNIIVMPVEL
GPWRAALDKEDGECNYLDSDFEAIAKEALRGLDLGVYFHPVLTGIGQGAT
IAYAAASDSPDATIAGAVSLDPTPARTRLPSCTEKAEAIKGPDGGFTYSV
NAALPAPALLISPPGSPVNNPVEARRKNIAVLQTAPDFSARMKMAVDNVV
AMADQDAKNEALPIIDLPAKGGNADMVAVFYSGDGGWRDIDKSIGEWLQA
HGVHVIGVDSLRYFWSERTPEEIANDTTAMIKKADPTGKLPVAVLGYSFG
ADTFPFAWKYLDPSIQDRTRMVGLLGVETTTTFQVSIEGWLGMNGDKDVV
PAIASIPLDRVVCVYGQEEDDTACTADELKGMDTIKLPGGHHFDENYEPI
AAALLDKMRSRAGLPPRPAR


References
4 more
    Title: Completion of the genome sequence of Brucella abortus and comparison to the highly similar genomes of Brucella melitensis and Brucella suis
    Halling SM, Peterson-Burch BD, Bricker BJ, Zuerner RL, Qing Z, Li LL, Kapur V, Alt DP, Olsen SC
    Ref: Journal of Bacteriology, 187:2715, 2005 : PubMed

            

    Title: The genome sequence of the facultative intracellular pathogen Brucella melitensis
    DelVecchio VG, Kapatral V, Redkar RJ, Patra G, Mujer C, Los T, Ivanova N, Anderson I, Bhattacharyya A and Overbeek R <15 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:443, 2002 : PubMed

            

    Title: The Brucella suis genome reveals fundamental similarities between animal and plant pathogens and symbionts
    Paulsen IT, Seshadri R, Nelson KE, Eisen JA, Heidelberg JF, Read TD, Dodson RJ, Umayam L, Brinkac LM and Fraser CM <21 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:13148, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer