Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cioin-141645

Ciona intestinalis gene ci0100141645

Comment
ci0100141645


Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Ciona intestinalis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Tunicata: N E > Ascidiacea: N E > Enterogona: N E > Phlebobranchia: N E > Cionidae: N E > Ciona: N E > Ciona intestinalis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : XM_002127344, EAAA01000753
2 UniProt : H2XYR8, H2Y0W3
1 Ncbi-nid : 198417534
1 Ncbi-pid : 198417535
2 UniProt : H2XYR8, H2Y0W3
2 Interpro : H2XYR8, H2Y0W3
2 Prodom : H2XYR8, H2Y0W3
2 Pfam : H2XYR8, H2Y0W3
2 PIRSF : H2XYR8, H2Y0W3
2 SUPERFAM : H2XYR8, H2Y0W3
1 JGI CIONA gene : 141645
Sequence
Graphical view for this peptide sequence: cioin-141645
Colored MSA for Carb_B_Chordata (raw)
MPTGRVISLPNYGKVKCGKITKAESCSVEVENYFGIPFAKPPIGKLRFSA
PQRAEPWAGILCEKSVKKIPLQSVGSLNLSSNFRISKNIFSQKNATEDCL
YLSIYAPSIRKSHPLPVMVWFYGGSFQMGPSVKFDATALAAMNEVIVVVP
NYRVGIFGFLSLGHETECKGNMGLLDQLESLKWVKENIEYFGGDKNNVTI
FGESAGGISVHMHMMSPLSAGYFHKAISHSGTANMPAVFAPPVNDQQRIV
TKLLESLNIKETDPSLVLHQLQNLPADQLVDYNAVQFRFGWYPTFDNHFF
KTSPEMATVAKVPFLLGCNSDEGGWLMALTTPNFISGLSKQEFSHYARIL
LRKYDKYLMQTIDYNKALPVLIMSLYGRMMGDCIFVNRIIQTSQANSDKG
VDTFLYFMSHPPLHKHARLPDHIGTDHADDIPFTFGLPFLPNSLKSGYRF
SADEAKLSKNMMTFFTNFAKTGNPNKPLPLETEWPLYNSESRKHVEFTVP
SIKVGSNLGQDKLHLYNKKLAKL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPTGRVISLPNYGKVKCGKITKAESCSVEVENYFGIPFAKPPIGKLRFSA
PQRAEPWAGILCEKSVKKIPLQSVGSLNLSSNFRISKNIFSQKNATEDCL
YLSIYAPSIRKSHPLPVMVWFYGGSFQMGPSVKFDATALAAMNEVIVVVP
NYRVGIFGFLSLGHETECKGNMGLLDQLESLKWVKENIEYFGGDKNNVTI
FGESAGGISVHMHMMSPLSAGYFHKAISHSGTANMPAVFAPPVNDQQRIV
TKLLESLNIKETDPSLVLHQLQNLPADQLVDYNAVQFRFGWYPTFDNHFF
KTSPEMATVAKVPFLLGCNSDEGGWLMALTTPNFISGLSKQEFSHYARIL
LRKYDKYLMQTIDYNKALPVLIMSLYGRMMGDCIFVNRIIQTSQANSDKG
VDTFLYFMSHPPLHKHARLPDHIGTDHADDIPFTFGLPFLPNSLKSGYRF
SADEAKLSKNMMTFFTNFAKTGNPNKPLPLETEWPLYNSESRKHVEFTVP
SIKVGSNLGQDKLHLYNKKLAKL


References
    Title: The draft genome of Ciona intestinalis: insights into chordate and vertebrate origins
    Dehal P, Satou Y, Campbell RK, Chapman J, Degnan B, De Tomaso A, Davidson B, Di Gregorio A, Gelpke M and Rokhsar DS <77 more author(s)>
    Ref: Science, 298:2157, 2002 : PubMed

            

    Title: A cDNA resource from the basal chordate Ciona intestinalis
    Satou Y, Yamada L, Mochizuki Y, Takatori N, Kawashima T, Sasaki A, Hamaguchi M, Awazu S, Yagi K and Satoh N <4 more author(s)>
    Ref: Genesis, 33:153, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer