Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cioin-F6T1M3

Ciona intestinalis similar to LOC443703 protein

Comment
F6T1M3 some differences with XP_002127407


Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Ciona intestinalis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Tunicata: N E > Ascidiacea: N E > Enterogona: N E > Phlebobranchia: N E > Cionidae: N E > Ciona: N E > Ciona intestinalis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : XM_002127371, XP_026696483, XP_002127407
1 Ncbi-nid : 198430755
1 Ncbi-pid : 198430756
Sequence
Graphical view for this peptide sequence: cioin-F6T1M3
Colored MSA for Carb_B_Chordata (raw)
MSESPCVETAKGPVRGKVVGSSKYPNAKQVYRFSSIPFAKPPVGDLRFER
PQDAEPWSEVLDATKEIASPMQDLSMWEYMKPYVVFEDVDDKDFRNLQED
CLYLNVFTNNLDAKANLPVLVWLYGGGLSMGSAVYYDAKTICSMQDVVVV
IPNYRVNVFGFFTAGKDTKWKGNMGLYDQLKALEWVKHNVKSFGGNPDNV
TIFGESAGGLSVGCHVLSPLSRGYFHRAISHSGTATMPTMMKTEYTNFRK
CMLEHLKITATDPDEMVAALKKVSAEKILEAQGEAYKKFPMGAFGLTVDG
EFILGEGTETITKPESIAPVPYIVGCNNTEVCGILSVMIPEFATGATEEG
IEGYLKMLLQAEKFPSDSQREAVGKLLKEKYIQNYSVDDKHRWSKTAGEM
FADMWFIIPSLLQANAHADAGHPTYFYYMTQAAKVFHSKEYVLSGELKPK
VDFCECDHGDDLIYTFGYPHSTTKLAPVVKFTDEERKMSEQWMNYIANFA
KTGNPNTGDKEVPLQWPIYKSSERNHLTAQFPFGIGQNLSGDKFKFHTET
IAEMKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSESPCVETAKGPVRGKVVGSSKYPNAKQVYRFSSIPFAKPPVGDLRFER
PQDAEPWSEVLDATKEIASPMQDLSMWEYMKPYVVFEDVDDKDFRNLQED
CLYLNVFTNNLDAKANLPVLVWLYGGGLSMGSAVYYDAKTICSMQDVVVV
IPNYRVNVFGFFTAGKDTKWKGNMGLYDQLKALEWVKHNVKSFGGNPDNV
TIFGESAGGLSVGCHVLSPLSRGYFHRAISHSGTATMPTMMKTEYTNFRK
CMLEHLKITATDPDEMVAALKKVSAEKILEAQGEAYKKFPMGAFGLTVDG
EFILGEGTETITKPESIAPVPYIVGCNNTEVCGILSVMIPEFATGATEEG
IEGYLKMLLQAEKFPSDSQREAVGKLLKEKYIQNYSVDDKHRWSKTAGEM
FADMWFIIPSLLQANAHADAGHPTYFYYMTQAAKVFHSKEYVLSGELKPK
VDFCECDHGDDLIYTFGYPHSTTKLAPVVKFTDEERKMSEQWMNYIANFA
KTGNPNTGDKEVPLQWPIYKSSERNHLTAQFPFGIGQNLSGDKFKFHTET
IAEMKK


Reference
    Title: The draft genome of Ciona intestinalis: insights into chordate and vertebrate origins
    Dehal P, Satou Y, Campbell RK, Chapman J, Degnan B, De Tomaso A, Davidson B, Di Gregorio A, Gelpke M and Rokhsar DS <77 more author(s)>
    Ref: Science, 298:2157, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer