Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: dicdi-Q86HM5

Dictyostelium discoideum (Slime mold) hypothetical protein

Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Dictyostelium discoideum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Amoebozoa: N E > Mycetozoa: N E > Dictyosteliida: N E > Dictyostelium: N E > Dictyostelium discoideum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AC116957, AAFI02000012
1 UniProt : Q86HM5
1 UniProt : Q86HM5
1 Interpro : Q86HM5
1 Prodom : Q86HM5
1 Pfam : Q86HM5
1 PIRSF : Q86HM5
1 SUPERFAM : Q86HM5
Sequence
Graphical view for this peptide sequence: dicdi-Q86HM5
Colored MSA for Lipase_3 (raw)
MFFKTIVFILIINLLINLKRSNSSIIGKNGDYIFAYFSDLIYDPLAVKQN
QFISLGDKNNCLEWEVVLDNSKILAYKSSITNNLIISFKEYNSINIEDNA
HYFKVDCYIDPKGCGEVRNGFQGEYYDLYIQLYSIIDSCEKPYDIYFTGH
SVGGVIAFFATLDISIQRFNEKYIKSITCVTFGQPAIGDDKFLDYVKQNI
NKFTYRRYVNSYYNDTIRITDPYVSNTIFKHSINNTIYLKNNIEKIKSIN
QLHFLDSYLEFLRNDDYSPCNNYCNFKKDNGFNNNNFNQYHQYSCDVKGN
TEITMSINPIANRVMPFTYSICLLESRKAYNYYKYSSMRSCNIRYGQSLT
TIIDRSNDNRQLRMTANGKHVYIIVENHNLDYGNYSLTYNLSFTNQLEQL
LPPQIINCTIEKQYYFNMDVSITFKSNSFKSEKSNQKIKYFVYISRSDNT
WLRYKIKRSINSEFITKMFNIPYGKYSIVVTSYNGIESKPSNIGFVEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFFKTIVFILIINLLINLKRSNSSIIGKNGDYIFAYFSDLIYDPLAVKQN
QFISLGDKNNCLEWEVVLDNSKILAYKSSITNNLIISFKEYNSINIEDNA
HYFKVDCYIDPKGCGEVRNGFQGEYYDLYIQLYSIIDSCEKPYDIYFTGH
SVGGVIAFFATLDISIQRFNEKYIKSITCVTFGQPAIGDDKFLDYVKQNI
NKFTYRRYVNSYYNDTIRITDPYVSNTIFKHSINNTIYLKNNIEKIKSIN
QLHFLDSYLEFLRNDDYSPCNNYCNFKKDNGFNNNNFNQYHQYSCDVKGN
TEITMSINPIANRVMPFTYSICLLESRKAYNYYKYSSMRSCNIRYGQSLT
TIIDRSNDNRQLRMTANGKHVYIIVENHNLDYGNYSLTYNLSFTNQLEQL
LPPQIINCTIEKQYYFNMDVSITFKSNSFKSEKSNQKIKYFVYISRSDNT
WLRYKIKRSINSEFITKMFNIPYGKYSIVVTSYNGIESKPSNIGFVEL


References
    Title: The genome of the social amoeba Dictyostelium discoideum
    Eichinger L, Pachebat JA, Glockner G, Rajandream MA, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K and Kuspa A <87 more author(s)>
    Ref: Nature, 435:43, 2005 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of Dictyostelium discoideum
    Glockner G, Eichinger L, Szafranski K, Pachebat JA, Bankier AT, Dear PH, Lehmann R, Baumgart C, Parra G and Noegel AA <8 more author(s)>
    Ref: Nature, 418:79, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer