Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: dicdi-abhd

Dictyostelium discoideum (Slime mold) Abhydrolase domain-containing protein

Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Dictyostelium discoideum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Amoebozoa: N E > Mycetozoa: N E > Dictyosteliida: N E > Dictyostelium: N E > Dictyostelium discoideum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AAFI01000219, AAFI02000148
1 UniProt : Q54H38
1 UniProt : Q54H38
1 Interpro : Q54H38
1 Prodom : Q54H38
1 Pfam : Q54H38
1 PIRSF : Q54H38
1 SUPERFAM : Q54H38
Sequence
Graphical view for this peptide sequence: dicdi-abhd
Colored MSA for abh_upf0017 (raw)
MFSSRDKAEVKLYFDSNNEENQKILDQCPHLYQKYDKDVTINDRINNIED
SEPTIKNGVTFYPPYYLYNSHFMNYYGSYKIPKLNLKTRREILVNPIDGG
TISLDFFELGEFKEDTPTIVINHGLTGGSHERYVQYFAQRAYKEKGFRSV
VFNYRGCAGNPITADRAYSAVQLDDIKFVTEYLTKTALPLVKKWFLVGFS
LGSAILVNYMADAGKDSPYLAHVSISNPMNMVECTKNLSSTYINNLIYNK
GLANNLKRLFRKFDGRLDKYATKEQIMAAQTIADFDDLITSKMFGFETAH
DYYLAASSSKSIRNLVKPILFINAIDDPIAPTSGFPWKDFKSNPNTILCV
SRWGGHLGFISYEDHMSWSDKAAVEYLSTFLDDNNNNNDNDNKTE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFSSRDKAEVKLYFDSNNEENQKILDQCPHLYQKYDKDVTINDRINNIED
SEPTIKNGVTFYPPYYLYNSHFMNYYGSYKIPKLNLKTRREILVNPIDGG
TISLDFFELGEFKEDTPTIVINHGLTGGSHERYVQYFAQRAYKEKGFRSV
VFNYRGCAGNPITADRAYSAVQLDDIKFVTEYLTKTALPLVKKWFLVGFS
LGSAILVNYMADAGKDSPYLAHVSISNPMNMVECTKNLSSTYINNLIYNK
GLANNLKRLFRKFDGRLDKYATKEQIMAAQTIADFDDLITSKMFGFETAH
DYYLAASSSKSIRNLVKPILFINAIDDPIAPTSGFPWKDFKSNPNTILCV
SRWGGHLGFISYEDHMSWSDKAAVEYLSTFLDDNNNNNDNDNKTE


References
    Title: Proteomics fingerprinting of phagosome maturation and evidence for the role of a Galpha during uptake
    Gotthardt D, Blancheteau V, Bosserhoff A, Ruppert T, Delorenzi M, Soldati T
    Ref: Mol Cell Proteomics, 5:2228, 2006 : PubMed

            

    Title: The genome of the social amoeba Dictyostelium discoideum
    Eichinger L, Pachebat JA, Glockner G, Rajandream MA, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K and Kuspa A <87 more author(s)>
    Ref: Nature, 435:43, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer