Gene_locus Report for: dicdi-q54yd0 Dictyostelium discoideum (Slime mold) hypothetical protein
Comment
only n-term Pfam A Peptidase_S28 78 484 Relationship
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Eukaryota: N E > Amoebozoa: N E > Mycetozoa: N E > Dictyosteliida: N E > Dictyostelium: N E > Dictyostelium discoideum: N E
5_AlphaBeta_hydrolase :
dicdi-q54f01 Dictyostelium discoideum (Slime mold) hypothetical protein .
6_AlphaBeta_hydrolase :
dicdi-Q8MMX8 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54ct5 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54cu1 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54ek1 Dictyostelium discoideum (Slime mold) Esterase/lipase/thioesterase domain-containing protein ,
dicdi-q54g24 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54qe7 Dictyostelium discoideum (Slime mold) Esterase/lipase/thioesterase domain-containing protein ,
dicdi-q54sy6 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54t91 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54ye0 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q55du6 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q55gk7 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-Q54ZA6 Dictyostelium discoideum AX4 (Slime mold) chromosome 5, p1 clone:mnb8 (EC 3.3.2.3) (epoxide hydrolase) .
A85-EsteraseD-FGH :
dicdi-q54rl8 Dictyostelium discoideum (Slime mold) hypothetical protein .
ABHD11-Acetyl_transferase :
dicdi-q54qk2 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54y48 Dictyostelium discoideum (Slime mold) hypothetical protein .
ABHD13-BEM46 :
dicdi-q54h73 Dictyostelium discoideum (Slime mold) hypothetical protein .
abh_upf0017 :
dicdi-abhd Dictyostelium discoideum (Slime mold) Abhydrolase domain-containing protein .
Acidic_Lipase :
dicdi-q55eu1 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q55eu8 Dictyostelium discoideum (Slime mold) carboxylic ester hydrolase ,
dicdi-Q86KU7 Dictyostelium discoideum (Slime mold) similar to triglyceride lipase-cholesterol esterase ,
dicdi-q552c0 Dictyostelium discoideum (and AX4) (Slime mold) putative hydrolase ,
dicdi-q558u2 Dictyostelium discoideum (Slime mold) AB-hydrolase associated lipase region containing protein .
ACPH_Peptidase_S9 :
dicdi-q54d66 Dictyostelium discoideum (Slime mold) hypothetical protein .
AlphaBeta_hydrolase :
dicdi-P90528 Dictyostelium discoideum (Slime mold) cdna-11 ,
dicdi-q54m29 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54th2 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-Q86I88 Dictyostelium discoideum (Slime mold) hypothetical protein .
Arb2_FAM172A :
dicdi-f172a Dictyostelium discoideum (Slime mold). FAM172 family protein homolog .
BD-FAE :
dicdi-q54dj5 Dictyostelium discoideum (Slime mold) hypothetical protein .
Carboxypeptidase_S10 :
dicdi-q54dy7 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54vw1 Dictyostelium discoideum (Slime mold) putative carboxypeptidase ,
dicdi-Q869Q8 Dictyostelium discoideum (Slime mold) vitellogenic-like .
Cholinesterase-like :
dicdi-ACHE Dictyostelium discoideum strain AX4 Similar to P04058 Acetylcholinesterase ,
dicdi-crd2p Dictyostelium discoideum (Slime mold) cAMP-regulated D2 protein ,
dicdi-crysp Dictyostelium discoideum mRNA for crystal protein ,
dicdi-drgen Dictyostelium discoideum mRNA develop. regul. gene ,
dicdi-q54et7 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54n21 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54rl3 Dictyostelium discoideum (Slime mold) hypothetical protein .
Dienelactone_hydrolase :
dicdi-CMBL Dictyostelium discoideum (Slime mold) hypothetical protein .
DPP4N_Peptidase_S9 :
dicdi-q54u01 Dictyostelium discoideum (Slime mold) hypothetical protein .
Duf_676 :
dicdi-q54xl3 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-Q86HC9 Dictyostelium discoideum (Slime mold) esterase/lipase/thioesterase domain-containing protein .
Duf_726 :
dicdi-q54z90 Dictyostelium discoideum (Slime mold) Transmembrane protein ,
dicdi-q553t5 Dictyostelium discoideum (Slime mold) Transmembrane protein .
Duf_829 :
dicdi-q54gw5 Dictyostelium discoideum (Slime mold) Putative uncharacterized protein ,
dicdi-q54n85 Dictyostelium discoideum (Slime mold) Putative transmembrane protein ,
dicdi-q54xu1 Dictyostelium discoideum (Slime mold) Putative uncharacterized protein ,
dicdi-q54xu2 Dictyostelium discoideum (Slime mold) Putative uncharacterized protein ,
dicdi-q54yr8 Dictyostelium discoideum (Slime mold) Putative transmembrane protein ,
dicdi-q86iz7 Dictyostelium discoideum (Slime mold) Putative uncharacterized protein ,
dicdi-q557k5 Dictyostelium discoideum (Slime mold) Putative uncharacterized protein .
Duf_900 :
dicdi-q86h82 Dictyostelium discoideum (Slime mold) hypothetical protein .
FSH1 :
dicdi-q55d01 Dictyostelium discoideum (Slime mold) hypothetical protein .
Hormone-sensitive_lipase_like :
dicdi-cinbp Dictyostelium discoideum protein for H5 gene expressed during growth esterase/lipase/thioesterase domain-containing protein ,
dicdi-q54l36 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54qi3 Dictyostelium discoideum (Slime mold) hypothetical protein .
Kynurenine-formamidase :
dicdi-q54r44 Dictyostelium discoideum (Slime mold). N-formylkynurenine formamidase .
LIDHydrolase :
dicdi-u554 Dictyostelium discoideum (Slime mold) UPF0554 protein .
Lipase_3 :
dicdi-Q8MYE7 Dictyostelium discoideum (Slime mold) triacylglycerol lipase-like protein triacylglycerol lipase ,
dicdi-q54eq6 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54et1 Dictyostelium discoideum (Slime mold) hypothetical protein (c-term 526->) ,
dicdi-q54gx3 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54yl1 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q55d81 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-Q86HM5 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-Q86HM6 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q555h0 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q555h1 Dictyostelium discoideum (Slime mold) hypothetical protein .
LYsophospholipase_carboxylesterase :
dicdi-q54t49 Dictyostelium discoideum (Slime mold) hypothetical protein Acyl-protein thioesterase 1 homolog 1 ,
dicdi-q55fk4 Dictyostelium discoideum (Slime mold) hypothetical protein .
Maspardin-ACP33-SPG21_like :
dicdi-q54i38 Dictyostelium discoideum (Slime mold) hypothetical protein .
Monoglyceridelipase_lysophospholip :
dicdi-Q75JJ5 Dictyostelium discoideum (Slime mold) phospholipase, alternative splicing isoform ,
dicdi-y9086 Dictyostelium discoideum (Slime mold) Uncharacterized abhydrolase domain-containing protein DDB_G0269086 .
Ndr_family :
dicdi-q55bx3 Dictyostelium discoideum (Slime mold) hypothetical protein .
Palmitoyl-protein_thioesterase :
dicdi-q54cm0 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54ie5 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54n35 Dictyostelium discoideum (Slime mold) hypothetical protein .
PGAP1 :
dicdi-q54vc2 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54xe3 Dictyostelium discoideum (Slime mold) hypothetical protein .
PhoPQ_related :
dicdi-apra Dictyostelium discoideum (Slime mold) PhoPQ-activated pathogenicity-related protein ,
dicdi-q54li1 Dictyostelium discoideum (Slime mold) PhoPQ-activated pathogenicity-related protein ,
dicdi-q54sz3 Dictyostelium discoideum (Slime mold) PhoPQ-activated pathogenicity-related protein ,
dicdi-q86jb6 Dictyostelium discoideum (Slime mold) PhoPQ-activated pathogenicity-related protein ,
dicdi-q550s3 Dictyostelium discoideum (Slime mold) PhoPQ-activated pathogenicity-related protein .
PMH_Peptidase_S9 :
dicdi-q54in4 Dictyostelium discoideum (Slime mold) hypothetical protein .
PPase_methylesterase_euk :
dicdi-ppme1 Dictyostelium discoideum (Slime mold) Probable protein phosphatase methylesterase 1 .
Proline_iminopeptidase :
dicdi-q54kz1 Dictyostelium discoideum (Slime mold) hypothetical protein .
Prolylcarboxypeptidase :
dicdi-q54cf7 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54d54 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54g47 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q54gi7 Dictyostelium discoideum (Slime mold) hypothetical protein (fragment) ,
dicdi-q54h23 Dictyostelium discoideum (Slime mold) hypothetical protein ,
dicdi-q555e5 Dictyostelium discoideum (Slime mold) hypothetical protein .
S9N_PPCE_Peptidase_S9 :
dicdi-DPOA Dictyostelium discoideum (Slime mold) prolyl oligopeptidase (EC 3.4.21.26) .
S9N_PREPL_Peptidase_S9 :
dicdi-q54cl7 Dictyostelium discoideum (Slime mold) hypothetical protein Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can
retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Dictyostelium discoideum AX4:
N ,
E .
Molecular evidence
Database
No mutation No structure No kinetic No Substrate No inhibitor
Sequence
Graphical view for this peptide sequence: dicdi-q54yd0 No Colored MSA for this family :>dicdi-q54yd0
MKIKNKTTKCFTIIPPSLTTSTTKNIKLRNYNLNNIYIFLIIILINLIMI
EPIKSMENQINLTPLASMPVQPYYIFQQTINHLSYDTIGTFEQRFSVNKK
FVPINGKPKAVFFLVSGEGPLSSEIVNHNPFVQIANETQALIVALELRYY
GESMPFLNMNNSNMAYLTTDQILEDLATFQVFFTNKYQLNDIKWIIMGCS
YAGTISAWYRLKYPHLVTAAIASSSPFRAELRFTEYDVKVRQNLGAPCSK
AFKNLFSYIEHLMIKNNSYVKSKFTCERQLDDRMFLYLLSEALTYSVQYD
ARFKIISGFCPKFVKLTNSSEALLDMFSSYVKNMFLFQNVSCDAYNLYEF
ASNEIDYSGTRSWTWQLCREYGWFMVPSGPDSFKPQSLGECWWQNDVCKT
LYGRAMRPTVDRINMVYGSTNFKYISNVLFTNCGNDPWSTLSIDPSVSLP
FSQQIHIPGESHCANWLSEQPSDSIELKNARALA
Reference
Title: The genome of the social amoeba Dictyostelium discoideum
Eichinger L , Pachebat JA , Glockner G , Rajandream MA , Sucgang R , Berriman M , Song J , Olsen R , Szafranski K and Kuspa A <87 more author(s)>
Eichinger L , Pachebat JA , Glockner G , Rajandream MA , Sucgang R , Berriman M , Song J , Olsen R , Szafranski K , Xu Q , Tunggal B , Kummerfeld S , Madera M , Konfortov BA , Rivero F , Bankier AT , Lehmann R , Hamlin N , Davies R , Gaudet P , Fey P , Pilcher K , Chen G , Saunders D , Sodergren E , Davis P , Kerhornou A , Nie X , Hall N , Anjard C , Hemphill L , Bason N , Farbrother P , Desany B , Just E , Morio T , Rost R , Churcher C , Cooper J , Haydock S , van Driessche N , Cronin A , Goodhead I , Muzny D , Mourier T , Pain A , Lu M , Harper D , Lindsay R , Hauser H , James K , Quiles M , Madan Babu M , Saito T , Buchrieser C , Wardroper A , Felder M , Thangavelu M , Johnson D , Knights A , Loulseged H , Mungall K , Oliver K , Price C , Quail MA , Urushihara H , Hernandez J , Rabbinowitsch E , Steffen D , Sanders M , Ma J , Kohara Y , Sharp S , Simmonds M , Spiegler S , Tivey A , Sugano S , White B , Walker D , Woodward J , Winckler T , Tanaka Y , Shaulsky G , Schleicher M , Weinstock G , Rosenthal A , Cox EC , Chisholm RL , Gibbs R , Loomis WF , Platzer M , Kay RR , Williams J , Dear PH , Noegel AA , Barrell B , Kuspa A (- 87)
Ref: Nature, 435 :43, 2005 : PubMed Abstract ESTHER: Eichinger_2005_Nature_435_43 PubMedSearch: Eichinger 2005 Nature 435 43 PubMedID: 15875012 Gene_locus related to this paper: dicdi-abhd ,
dicdi-ACHE ,
dicdi-apra ,
dicdi-cinbp ,
dicdi-CMBL ,
dicdi-crysp ,
dicdi-DPOA ,
dicdi-P90528 ,
dicdi-ppme1 ,
dicdi-Q8MYE7 ,
dicdi-q54cf7 ,
dicdi-q54cl7 ,
dicdi-q54cm0 ,
dicdi-q54ct5 ,
dicdi-q54cu1 ,
dicdi-q54d54 ,
dicdi-q54d66 ,
dicdi-q54dj5 ,
dicdi-q54dy7 ,
dicdi-q54ek1 ,
dicdi-q54eq6 ,
dicdi-q54et1 ,
dicdi-q54et7 ,
dicdi-q54f01 ,
dicdi-q54g24 ,
dicdi-q54g47 ,
dicdi-q54gi7 ,
dicdi-q54gw5 ,
dicdi-q54gx3 ,
dicdi-q54h23 ,
dicdi-q54h73 ,
dicdi-q54i38 ,
dicdi-q54ie5 ,
dicdi-q54in4 ,
dicdi-q54kz1 ,
dicdi-q54l36 ,
dicdi-q54li1 ,
dicdi-q54m29 ,
dicdi-q54n21 ,
dicdi-q54n35 ,
dicdi-q54n85 ,
dicdi-q54qe7 ,
dicdi-q54qi3 ,
dicdi-q54qk2 ,
dicdi-q54rl3 ,
dicdi-q54rl8 ,
dicdi-q54sy6 ,
dicdi-q54sz3 ,
dicdi-q54t49 ,
dicdi-q54t91 ,
dicdi-q54th2 ,
dicdi-q54u01 ,
dicdi-q54vc2 ,
dicdi-q54vw1 ,
dicdi-q54xe3 ,
dicdi-q54xl3 ,
dicdi-q54xu1 ,
dicdi-q54xu2 ,
dicdi-q54y48 ,
dicdi-q54yd0 ,
dicdi-q54ye0 ,
dicdi-q54yl1 ,
dicdi-q54yr8 ,
dicdi-q54z90 ,
dicdi-q55bx3 ,
dicdi-q55d01 ,
dicdi-q55d81 ,
dicdi-q55du6 ,
dicdi-q55eu1 ,
dicdi-q55eu8 ,
dicdi-q55fk4 ,
dicdi-q55gk7 ,
dicdi-Q54ZA6 ,
dicdi-q86h82 ,
dicdi-Q86HC9 ,
dicdi-Q86HM5 ,
dicdi-Q86HM6 ,
dicdi-q86iz7 ,
dicdi-q86jb6 ,
dicdi-Q86KU7 ,
dicdi-q550s3 ,
dicdi-q552c0 ,
dicdi-q553t5 ,
dicdi-q555e5 ,
dicdi-q555h0 ,
dicdi-q555h1 ,
dicdi-q557k5 ,
dicdi-q558u2 ,
dicdi-Q869Q8 ,
dicdi-u554 ,
dicdi-y9086 ,
dicdi-q54r44 ,
dicdi-f172a Abstract
The social amoebae are exceptional in their ability to alternate between unicellular and multicellular forms. Here we describe the genome of the best-studied member of this group, Dictyostelium discoideum. The gene-dense chromosomes of this organism encode approximately 12,500 predicted proteins, a high proportion of which have long, repetitive amino acid tracts. There are many genes for polyketide synthases and ABC transporters, suggesting an extensive secondary metabolism for producing and exporting small molecules. The genome is rich in complex repeats, one class of which is clustered and may serve as centromeres. Partial copies of the extrachromosomal ribosomal DNA (rDNA) element are found at the ends of each chromosome, suggesting a novel telomere structure and the use of a common mechanism to maintain both the rDNA and chromosomal termini. A proteome-based phylogeny shows that the amoebozoa diverged from the animal-fungal lineage after the plant-animal split, but Dictyostelium seems to have retained more of the diversity of the ancestral genome than have plants, animals or fungi.
         Other Papers