Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: entfa-EF1236

Enterococcus faecalis (Streptococcus faecalis) acetyl xylan esterase, putative

Comment
Other strains: Enterococcus faecalis ( V583; ATCC 4200; TX1342; TX0109; TX1302; TX0012; S613; TX0102; TX0043; TX0312; TX0860; TX0470; TX2137; TX0031; R712; ATCC 29200; DAPTO 512; DAPTO 516; T11; Merz96; D6; Fly1; T2; T1; T3; T8; TX1322; TX4000; TX0411; TX1346; E1Sol; ARO1/DG; HIP11704; DS5; JH1; CH188; TX1341; TX0645; TX0027; TX2141; TX0635; TX0309A; ATCC 47077 / OG1RF; 62; TX4248; TX0630; TX2134; TX4244; TUSoD Ef11; HH22; TX0017; TX0309B; TX0855; PC1.1; TX0104) Enterococcus sp.( 7L76)


Relationship
Family|Acetyl-esterase_deacetylase
Block| X
Position in NCBI Life Tree|Enterococcus faecalis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Enterococcaceae: N E > Enterococcus: N E > Enterococcus faecalis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: entfa-EF1236
Colored MSA for Acetyl-esterase_deacetylase (raw)
MNEYFEFWQKTKEELQKIPLDIHRRVIDYPLENVQVEQVDFLSFLGERIF
GYLLLPKTAGKQPIVIDCLGYMNHIQEPWQFAHWTQIGCACFVIDNRGQG
GLTKDRVPYQTIWHEAPMGRGFLDKEDWYQRRLFADHLRSVEVVRTFTEI
NQDQIILRGGSQGGGVVLMVNSLVDFPILATFADVPSHSCLENRVAEGTG
SYQIIHQYLQEHPQAHEKIAAVLPYFDSRHFVSQIKNPVFASVGSHDPIC
PMKDFFPSYHQIKARKAVRVYWKKGHGGGETTQIRREMRQIQQLLQEVKN
ENSYV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNEYFEFWQKTKEELQKIPLDIHRRVIDYPLENVQVEQVDFLSFLGERIF
GYLLLPKTAGKQPIVIDCLGYMNHIQEPWQFAHWTQIGCACFVIDNRGQG
GLTKDRVPYQTIWHEAPMGRGFLDKEDWYQRRLFADHLRSVEVVRTFTEI
NQDQIILRGGSQGGGVVLMVNSLVDFPILATFADVPSHSCLENRVAEGTG
SYQIIHQYLQEHPQAHEKIAAVLPYFDSRHFVSQIKNPVFASVGSHDPIC
PMKDFFPSYHQIKARKAVRVYWKKGHGGGETTQIRREMRQIQQLLQEVKN
ENSYV


References
1 more
    Title: Large scale variation in Enterococcus faecalis illustrated by the genome analysis of strain OG1RF
    Bourgogne A, Garsin DA, Qin X, Singh KV, Sillanpaa J, Yerrapragada S, Ding Y, Dugan-Rocha S, Buhay C and Weinstock GM <18 more author(s)>
    Ref: Genome Biol, 9:R110, 2008 : PubMed

            

    Title: Genome-wide cloning and characterization of microbial esterases
    Ro HS, Hong HP, Kho BH, Kim S, Chung BH
    Ref: FEMS Microbiology Letters, 233:97, 2004 : PubMed

            

    Title: Role of mobile DNA in the evolution of vancomycin-resistant Enterococcus faecalis
    Paulsen IT, Banerjei L, Myers GS, Nelson KE, Seshadri R, Read TD, Fouts DE, Eisen JA, Gill SR and Fraser CM <22 more author(s)>
    Ref: Science, 299:2071, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer