Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-FAM135A

Homo sapiens (Human) F135A DKFZp781H2319 FLJ20176 fis KIAA1411 previously human-F135A

Comment
only c-term Pfam A DUF676 1244 1440


Relationship
Family|Duf_676
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 4 more: AB037832, AL078591, CR749254
1 UniProt : D6RCC7
2 UniProt : Q9P2D6, D6RCC7
2 Interpro : Q9P2D6, D6RCC7
2 Prodom : Q9P2D6, D6RCC7
2 Pfam : Q9P2D6, D6RCC7
2 PIRSF : Q9P2D6, D6RCC7
2 SUPERFAM : Q9P2D6, D6RCC7
1 EntrezGene : 57579
1 SNP : 57579
1 UniGene : 211700
1 HUGO HGNC : 21084
1 Ensembl : ENSG00000082269
Sequence
Graphical view for this peptide sequence: human-FAM135A
Colored MSA for Duf_676 (raw)
AFLQAKEELKLLKLPGFMYSEVPLLASSVPYFSVEEEDGSEDGVHLIVCV
HGLDGNSADLRLVKTYIELGLPGGRIDFLMSERNQNDTFADFDSMTDRLL
DEIIQYIQIYSLTVSKISFIGHSLGNLIIRSVLTRPRFKYYLNKLHTFLS
LSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDHSDPRQTFLYK
LSNKAGLHYFKNVVLVGSLQDRYVPYHSARIEMCKTALKDKQSGQIYSEM
IHNLLRPVLQSKDCNLVRYNVINALPNTADSLIGRAAHIAVLDSEIFLEK
FFLVAALKYFQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

AFLQAKEELKLLKLPGFMYSEVPLLASSVPYFSVEEEDGSEDGVHLIVCV
HGLDGNSADLRLVKTYIELGLPGGRIDFLMSERNQNDTFADFDSMTDRLL
DEIIQYIQIYSLTVSKISFIGHSLGNLIIRSVLTRPRFKYYLNKLHTFLS
LSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDHSDPRQTFLYK
LSNKAGLHYFKNVVLVGSLQDRYVPYHSARIEMCKTALKDKQSGQIYSEM
IHNLLRPVLQSKDCNLVRYNVINALPNTADSLIGRAAHIAVLDSEIFLEK
FFLVAALKYFQ


References
2 more
    Title: The DNA sequence and analysis of human chromosome 6
    Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE and Beck S <161 more author(s)>
    Ref: Nature, 425:805, 2003 : PubMed

            

    Title: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs
    Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Boecher M, Bloecker H, Bauersachs S and Ottenwalder B <20 more author(s)>
    Ref: Genome Res, 11:422, 2001 : PubMed

            

    Title: Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro
    Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O
    Ref: DNA Research, 7:65, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer