Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: neucr-B19A17.360

Neurospora crassa, Neurospora tetrasperma hypothetical protein b19a17.360 Acetylxylan esterase

Comment
Other strains: Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DS 1257 / FGSC 987), Neurospora tetrasperma (strain FGSC 2509 / P0656; FGSC 2508 / ATCC MYA-4615 / P0657) contains a c-terminus 267-300 carbohydrate-binding module (CBM) Fungal cellulose binding domain most often associated with glycosyl hydrolases not related to alpha beta hydrolases


Relationship
Family|Acetylxylan_esterase
Block| X
Position in NCBI Life Tree|Neurospora crassa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Sordariomycetidae: N E > Sordariales: N E > Sordariaceae: N E > Neurospora: N E > Neurospora crassa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: BX284763, GL891269, CM002241
>3 UniProt links 1 more: Q872L7, G4V0W0, Q1K583
>3 UniProt links 1 more: Q872L7, G4V0W0, Q1K583
>3 Interpro links 1 more: Q872L7, G4V0W0, Q1K583
>3 Pfam links 1 more: Q872L7, G4V0W0, Q1K583
>3 PIRSF links 1 more: Q872L7, G4V0W0, Q1K583
>3 SUPERFAM links 1 more: Q872L7, G4V0W0, Q1K583
Sequence
Graphical view for this peptide sequence: neucr-B19A17.360
Colored MSA for Acetylxylan_esterase (raw)
MWPSPKAAYLLLLARSALVGASPVELEERQSCPSIHVFGARETTVSPGFG
TAGVVVNLILQAYPGATSEAIVYPACGGQSSCGGVQYGDSARQGTNAVAT
AVNSLNARCPDTQIVLVGYSQGGQIMDNAVCGGPDSGAGITTSTPGINAS
ALNQVKAVIMMGNPRYRAGLSYNVGTCTAYGFDPRPAGYTCASASKLQNY
CDSPDPYCCTGNDANTHQGYGSKYGQQALAFVKSKLSSGGGGGGGSTPTT
PSNPSTPTNPSTGNCA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWPSPKAAYLLLLARSALVGASPVELEERQSCPSIHVFGARETTVSPGFG
TAGVVVNLILQAYPGATSEAIVYPACGGQSSCGGVQYGDSARQGTNAVAT
AVNSLNARCPDTQIVLVGYSQGGQIMDNAVCGGPDSGAGITTSTPGINAS
ALNQVKAVIMMGNPRYRAGLSYNVGTCTAYGFDPRPAGYTCASASKLQNY
CDSPDPYCCTGNDANTHQGYGSKYGQQALAFVKSKLSSGGGGGGGSTPTT
PSNPSTPTNPSTGNCA


References
    Title: Massive changes in genome architecture accompany the transition to self-fertility in the filamentous fungus Neurospora tetrasperma
    Ellison CE, Stajich JE, Jacobson DJ, Natvig DO, Lapidus A, Foster B, Aerts A, Riley R, Lindquist EA and Taylor JW <1 more author(s)>
    Ref: Genetics, 189:55, 2011 : PubMed

            

    Title: The genome sequence of the filamentous fungus Neurospora crassa
    Galagan JE, Calvo SE, Borkovich KA, Selker EU, Read ND, Jaffe D, FitzHugh W, Ma LJ, Smirnov S and Birren B <67 more author(s)>
    Ref: Nature, 422:859, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer