Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orysa-q6i5u7

Oryza sativa (strains japonica cultivar-group; subsp. indica) putative embryogenesis-associated protein

Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Oryza sativa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AC108502, AC105769, CM000130
2 UniProt : Q6I5U7, A2Y501
2 UniProt : Q6I5U7, A2Y501
2 Interpro : Q6I5U7, A2Y501
2 Pfam : Q6I5U7, A2Y501
2 PIRSF : Q6I5U7, A2Y501
2 SUPERFAM : Q6I5U7, A2Y501
Sequence
Graphical view for this peptide sequence: orysa-q6i5u7
Colored MSA for abh_upf0017 (raw)
MGNAAAGDSAAELLLRAAALVPPAHYALAALLLACALLYRFLELHLIGDL
LRGLRGGRVALTFHPASHVYHRVASKCRSLHGRYLATPWLASPHLQTLFL
SISGRPPSFTYRRQLYTVRDGGTIALDWLLASDCEEEDVGFCDGVISRDD
STPLVVVIPGLTSDSTAAYVKHLVFSMASKGWNVVVGNHRGLGGISITSD
CFYNAGWTEDFREIVNYLHQKYPQAPLFAVGTSIGANILVKYLGEEGEGT
PVAGAVSICSPWDLLVTNRFIQRKLVQRCYDKALAIGLKGYAKLHQPVLA
RLANWEDIRKSRSIREFDRHATCVVAKYETVDTFYRRCSSANYISNVSVP
LLCISALDDPLCTREAIPWDECRANKNIVLATAPNGGHLAFFQGLTAGKL
WWVGAVSEFLLALHDSPCMHRQKAQEHSLHTSLESSIDKSPYVNFMEDGM
VTAVTNDDANNSDSDNPISNEMELRNGMVGVQQDGIATEIQNECDGNRSQ
ENVTPAQGPVGSQEQPKQNIDKIQDAIAPVKISINQLIRSQGRSVWLLTY
IAFVTSWPFLGALGFILFRKKFRNSLPAKRL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGNAAAGDSAAELLLRAAALVPPAHYALAALLLACALLYRFLELHLIGDL
LRGLRGGRVALTFHPASHVYHRVASKCRSLHGRYLATPWLASPHLQTLFL
SISGRPPSFTYRRQLYTVRDGGTIALDWLLASDCEEEDVGFCDGVISRDD
STPLVVVIPGLTSDSTAAYVKHLVFSMASKGWNVVVGNHRGLGGISITSD
CFYNAGWTEDFREIVNYLHQKYPQAPLFAVGTSIGANILVKYLGEEGEGT
PVAGAVSICSPWDLLVTNRFIQRKLVQRCYDKALAIGLKGYAKLHQPVLA
RLANWEDIRKSRSIREFDRHATCVVAKYETVDTFYRRCSSANYISNVSVP
LLCISALDDPLCTREAIPWDECRANKNIVLATAPNGGHLAFFQGLTAGKL
WWVGAVSEFLLALHDSPCMHRQKAQEHSLHTSLESSIDKSPYVNFMEDGM
VTAVTNDDANNSDSDNPISNEMELRNGMVGVQQDGIATEIQNECDGNRSQ
ENVTPAQGPVGSQEQPKQNIDKIQDAIAPVKISINQLIRSQGRSVWLLTY
IAFVTSWPFLGALGFILFRKKFRNSLPAKRL


Reference
    Title: The Genomes of Oryza sativa: a history of duplications
    Yu J, Wang J, Lin W, Li S, Li H, Zhou J, Ni P, Dong W, Hu S and Yang H <88 more author(s)>
    Ref: PLoS Biol, 3:e38, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer