Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orysa-q7xej4

Oryza sativa (japonica cultivar-group) Oryza sativa subsp. indica (Rice), Oryza glaberrima (African rice), putative submergence induced protein 2

Comment
Other strains: Oryza sativa (japonica cultivar-group) Oryza sativa subsp. indica (Rice), Oryza glaberrima (African rice)


Relationship
Family|Chlorophyllase_Plant
Block| L
Position in NCBI Life Tree|Oryza sativa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: AE017095, CM000135, CM000147
>3 UniProt links 2 more: Q7XEJ4, B8BGV7, B9G5S3
>3 UniProt links 2 more: Q7XEJ4, B8BGV7, B9G5S3
>3 Interpro links 2 more: Q7XEJ4, B8BGV7, B9G5S3
>3 Pfam links 2 more: Q7XEJ4, B8BGV7, B9G5S3
>3 PIRSF links 2 more: Q7XEJ4, B8BGV7, B9G5S3
>3 SUPERFAM links 2 more: Q7XEJ4, B8BGV7, B9G5S3
Sequence
Graphical view for this peptide sequence: orysa-q7xej4
Colored MSA for Chlorophyllase_Plant (raw)
MIAFAAQILAFCLLLLLLLLLQLQTTMAGDSSFSGVFDHGSHGVTLVKVD
EAPRKCSSAAAAKKTDDDTAPAGGAPPKPLLVAAPCDAGVYPVVVFLHGY
LAYNSFYSQLFEHVASHGFVVVGPQLFLGCELILSNNFDAKMLYTMSGPD
TTDEINSAAAVINWLAAGGLTSKLPPNVRADATKISISGHSRGGKVAFAL
ALGHANVSLRGGAGGATIAALVAVDPVDGFAAGKQTPPPILTYGGANSLR
VPAPVMVIGTGLGGLARAAPLLPACAPPGVSHGEFYGECAAPACHLVARD
YGHTDMMDDVTPGARGLATRAVCRSGGARAPMRRFFGGAMVAFVKRWVEG
EPELLDCVRARPETAPVVLSAVEFRDEAIANHSY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIAFAAQILAFCLLLLLLLLLQLQTTMAGDSSFSGVFDHGSHGVTLVKVD
EAPRKCSSAAAAKKTDDDTAPAGGAPPKPLLVAAPCDAGVYPVVVFLHGY
LAYNSFYSQLFEHVASHGFVVVGPQLFLGCELILSNNFDAKMLYTMSGPD
TTDEINSAAAVINWLAAGGLTSKLPPNVRADATKISISGHSRGGKVAFAL
ALGHANVSLRGGAGGATIAALVAVDPVDGFAAGKQTPPPILTYGGANSLR
VPAPVMVIGTGLGGLARAAPLLPACAPPGVSHGEFYGECAAPACHLVARD
YGHTDMMDDVTPGARGLATRAVCRSGGARAPMRRFFGGAMVAFVKRWVEG
EPELLDCVRARPETAPVVLSAVEFRDEAIANHSY


References
    Title: Improvement of the Oryza sativa Nipponbare reference genome using next generation sequence and optical map data
    Kawahara Y, de la Bastide M, Hamilton JP, Kanamori H, McCombie WR, Ouyang S, Schwartz DC, Tanaka T, Wu J and Matsumoto T <12 more author(s)>
    Ref: Rice (N Y), 6:4, 2013 : PubMed

            

    Title: The Genomes of Oryza sativa: a history of duplications
    Yu J, Wang J, Lin W, Li S, Li H, Zhou J, Ni P, Dong W, Hu S and Yang H <88 more author(s)>
    Ref: PLoS Biol, 3:e38, 2005 : PubMed

            

    Title: In-depth view of structure, activity, and evolution of rice chromosome 10.
    Yu Y
    Ref: Science, 300:1566, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer