Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psepu-acoc

Pseudomonas putida dihydrolipoamide acetyltransferase (acoC)

Comment
Other strains: Pseudomonas putida (strains kt2440; F1; GB-1) . Q88QE1 from strain kt2440 some aa diff . only c-term Pfam A Abhydrolase_6 136 362


Relationship
Family|AcoC_BiotinLipoyl-ABH
Block| X
Position in NCBI Life Tree|Pseudomonas putida
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas putida group: N E > Pseudomonas putida: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: L35343, 2104227D, AE016776
3 UniProt : Q59695, A5VY00, B0KLA5
1 Ncbi-nid : 529559
1 Ncbi-pid : 529563
>3 UniProt links 1 more: Q59695, Q88QE1, A5VY00
>3 Interpro links 1 more: Q59695, Q88QE1, A5VY00
>3 Pfam links 1 more: Q59695, Q88QE1, A5VY00
>3 PIRSF links 1 more: Q59695, Q88QE1, A5VY00
>3 SUPERFAM links 1 more: Q59695, Q88QE1, A5VY00
Sequence
Graphical view for this peptide sequence: psepu-acoc
Colored MSA for AcoC_BiotinLipoyl-ABH (raw)
RLLRWFELGGEGGTPLVLVHGFGGDLNNWLFNHPALAAERRVIALDLPGH
GESAKALQRGDLDELSETVLALLDHLDIAKAHLAGHSMGGAVSLNVAGLA
PQRVASLSLIASAGLGEAINGQYLQGFVAAANRNALKPQMVQLFADPALV
TRQMLEDMLKFKRLEGVDEALRQLALAIADGDRQRHDLRSVLGQHPALVV
WGGKDAIIPASHARKGPEAEVLVLPEAGHMVQMEAAEQVNQQMLAFLRKH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

RLLRWFELGGEGGTPLVLVHGFGGDLNNWLFNHPALAAERRVIALDLPGH
GESAKALQRGDLDELSETVLALLDHLDIAKAHLAGHSMGGAVSLNVAGLA
PQRVASLSLIASAGLGEAINGQYLQGFVAAANRNALKPQMVQLFADPALV
TRQMLEDMLKFKRLEGVDEALRQLALAIADGDRQRHDLRSVLGQHPALVV
WGGKDAIIPASHARKGPEAEVLVLPEAGHMVQMEAAEQVNQQMLAFLRKH


References
    Title: Complete genome sequence and comparative analysis of the metabolically versatile Pseudomonas putida KT2440
    Nelson KE, Weinel C, Paulsen IT, Dodson RJ, Hilbert H, Martins dos Santos VA, Fouts DE, Gill SR, Pop M and Fraser CM <33 more author(s)>
    Ref: Environ Microbiol, 4:799, 2002 : PubMed

            

    Title: Molecular characterization of the Pseudomonas putida 2,3-butanediol catabolic pathway.
    Huang M, Oppermann FB, Steinbuchel A
    Ref: FEMS Microbiology Letters, 124:141, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer