Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: schma-c4qmk4

Schistosoma mansoni (Blood fluke, platyhelminth) Expressed protein

Relationship
Family|ABHD18
Block| X
Position in NCBI Life Tree|Schistosoma mansoni
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Platyhelminthes: N E > Trematoda: N E > Digenea: N E > Strigeidida: N E > Schistosomatoidea: N E > Schistosomatidae: N E > Schistosoma: N E > Schistosoma mansoni: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : FN357874
1 UniProt : A0A5K4EZ72
1 Interpro : A0A5K4EZ72
1 Pfam : A0A5K4EZ72
1 PIRSF : A0A5K4EZ72
1 SUPERFAM : A0A5K4EZ72
Sequence
Graphical view for this peptide sequence: schma-c4qmk4
Colored MSA for ABHD18 (raw)
MIIPRKWSTNYRAVCIHFSGTGDQNYYRRRVFLASSLIKDGIASIILMHP
FYSKRKPDEQQGSGLNSVSDLFIMGGALIMECSALLKWCEHNGYGPFALH
GISMGGYMSALCATVWPKPISLIPCLSWTSASCVFLEGILSNTVNWSVLT
KQYYSDSAYSDVIRPQIQPAVPEFCKVTDETSNDTLGDYLQNSPRTPVSI
NSLHSKYSDPVNVASLAAFSKQSDSRLHPIKRHSLKSSHSNFQVRDILSQ
FINMSNSASQLSSSHSNTHKFTVAEKFLPSIMYTGFPNFLSSFNFNKVFR
FQSNSSRWHKQIPSFPRVSSPSVSFLRTNLSPDPEVRQFLRDLLDYFTHL
GNFSPVIDSRLVLSVAAEYDAYVPRGSVCSLKIVYPNGEIRFLPQSGHVG
AYVKNSIWTNDFRKAISDCLNQQVQLYHHEPGPFGRINTTRKNVQLIKH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIIPRKWSTNYRAVCIHFSGTGDQNYYRRRVFLASSLIKDGIASIILMHP
FYSKRKPDEQQGSGLNSVSDLFIMGGALIMECSALLKWCEHNGYGPFALH
GISMGGYMSALCATVWPKPISLIPCLSWTSASCVFLEGILSNTVNWSVLT
KQYYSDSAYSDVIRPQIQPAVPEFCKVTDETSNDTLGDYLQNSPRTPVSI
NSLHSKYSDPVNVASLAAFSKQSDSRLHPIKRHSLKSSHSNFQVRDILSQ
FINMSNSASQLSSSHSNTHKFTVAEKFLPSIMYTGFPNFLSSFNFNKVFR
FQSNSSRWHKQIPSFPRVSSPSVSFLRTNLSPDPEVRQFLRDLLDYFTHL
GNFSPVIDSRLVLSVAAEYDAYVPRGSVCSLKIVYPNGEIRFLPQSGHVG
AYVKNSIWTNDFRKAISDCLNQQVQLYHHEPGPFGRINTTRKNVQLIKH


References
    Title: A systematically improved high quality genome and transcriptome of the human blood fluke Schistosoma mansoni
    Protasio AV, Tsai IJ, Babbage A, Nichol S, Hunt M, Aslett MA, De Silva N, Velarde GS, Anderson TJ and Berriman M <14 more author(s)>
    Ref: PLoS Negl Trop Dis, 6:e1455, 2012 : PubMed

            

    Title: The genome of the blood fluke Schistosoma mansoni
    Berriman M, Haas BJ, LoVerde PT, Wilson RA, Dillon GP, Cerqueira GC, Mashiyama ST, Al-Lazikani B, Andrade LF and El-Sayed NM <46 more author(s)>
    Ref: Nature, 460:352, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer