Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: xanax-estA1

Xanthomonas axonopodis, Xanthomonas fuscans, Xanthomonas vesicatoria, Xanthomonas perforans, Xanthomonas gardneri, Xanthomonas citri, Xanthomonas vasicola, Xanthomonas campestris pv. viticola estA1 gene

Comment
Other strains: Xanthomonas axonopodis (pv. citri str. 306; pv. punicae str. LMG 859; pv. malvacearum str. (GSPB2388; Xac29-1; GSPB1386)); Xanthomonas fuscans (subsp. aurantifolii (ICPB 10535; 11122); subsp. fuscans) Xanthomonas vesicatoria ATCC 35937 ,Xanthomonas perforans 91-118, Xanthomonas gardneri (ATCC 19865 pv. citrumelo F1), Xanthomonas citri (pv. mangiferaeindicae LMG 941; subsp. citri Aw12879), Xanthomonas vasicola pv. vasculorum NCPPB (890; 895; 206), Xanthomonas campestris pv. musacearum NCPPB (2005; 4379; 4380; 4392; 4394; 4384)


Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Xanthomonas axonopodis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Xanthomonadales: N E > Xanthomonadaceae: N E > Xanthomonas: N E > Xanthomonas axonopodis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: xanax-estA1
Colored MSA for Carb_B_Bacteria (raw)
MRGGALRGYRDQGVCVFKGIPYGGDTAPRRFQAPLQETPWHHVRDASGFG
AAAPQPKASEPTSEDCLFLNVWTPGLRDGGKRPVLFYIHGGGYTTGSGSD
PLYDGVRLCKRGDVVVVTVNHRLNLFGYLSLAQLGDASFADSGNAGQLDL
IQALQWVRQHAAEFGGDAGNVTVFGQSGGGAKIATLMAMPAARGLFHRAW
TMSGQQVTVAGPRAATQRAQLLLDALKISPSEIARMRTLPVAQLLGAAHV
RDPSRVESTALYFGPVLDARNVPVHPFWPTAPVQSARIPMVIGNTRDETR
GFLGNDAKNFALSWDELPARLEAQQYVDLLPQVVIAEYRRLYPQYTPSQV
FFAATTAGRSWRGAVEEAQARARQGAPTWVYQLDWGSPLDGGKFGAFHTL
DIPLVFDNVRQPGSRTGDGADAQRMAEQMSEALLAFARQGDPNRRGAPYW
KPYSLKRRETLVFDTPSRLELDPRGGERLLYQQAPFIQRGTF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRGGALRGYRDQGVCVFKGIPYGGDTAPRRFQAPLQETPWHHVRDASGFG
AAAPQPKASEPTSEDCLFLNVWTPGLRDGGKRPVLFYIHGGGYTTGSGSD
PLYDGVRLCKRGDVVVVTVNHRLNLFGYLSLAQLGDASFADSGNAGQLDL
IQALQWVRQHAAEFGGDAGNVTVFGQSGGGAKIATLMAMPAARGLFHRAW
TMSGQQVTVAGPRAATQRAQLLLDALKISPSEIARMRTLPVAQLLGAAHV
RDPSRVESTALYFGPVLDARNVPVHPFWPTAPVQSARIPMVIGNTRDETR
GFLGNDAKNFALSWDELPARLEAQQYVDLLPQVVIAEYRRLYPQYTPSQV
FFAATTAGRSWRGAVEEAQARARQGAPTWVYQLDWGSPLDGGKFGAFHTL
DIPLVFDNVRQPGSRTGDGADAQRMAEQMSEALLAFARQGDPNRRGAPYW
KPYSLKRRETLVFDTPSRLELDPRGGERLLYQQAPFIQRGTF


References
6 more
    Title: Comparative genomics reveals diversity among xanthomonads infecting tomato and pepper
    Potnis N, Krasileva K, Chow V, Almeida NF, Patil PB, Ryan RP, Sharlach M, Behlau F, Dow JM and Jones JB <8 more author(s)>
    Ref: BMC Genomics, 12:146, 2011 : PubMed

            

    Title: Novel insights into the genomic basis of citrus canker based on the genome sequences of two strains of Xanthomonas fuscans subsp. aurantifolii
    Moreira LM, Almeida NF, Jr., Potnis N, Digiampietri LA, Adi SS, Bortolossi JC, da Silva AC, da Silva AM, de Moraes FE and Setubal JC <21 more author(s)>
    Ref: BMC Genomics, 11:238, 2010 : PubMed

            

    Title: Comparison of the genomes of two Xanthomonas pathogens with differing host specificities
    da Silva ACR, Ferro JA, Reinach FC, Farah CS, Furlan LR, Quaggio RB, Monteiro-Vitorello CB, Van Sluys MA, Almeida Jr NF and Kitajima JP <55 more author(s)>
    Ref: Nature, 417:459, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer