Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yerpe-YPO2002

Yersinia pestis Yersinia pseudotuberculosis hypothetical protein ypo2002

Comment
In some bacteria a gene fusion event leads to expression of a CMD with a hydrolase involved in the same pathway In these bifunctional proteins (e.g. O67982) CMD represents the C-terminal domain, Abhydrolase_1 represents the N-terminal domain


Relationship
Family|YcjY-like
Block| X
Position in NCBI Life Tree|Yersinia pestis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Yersiniaceae: N E > Yersinia: N E > Yersinia pseudotuberculosis complex: N E > Yersinia pestis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: BX936398, AJ414151, AE013833
1 UniProt : Q66AY6
2 UniProt : Q7CI95, Q66AY6
2 Interpro : Q7CI95, Q66AY6
2 Prodom : Q7CI95, Q66AY6
2 Pfam : Q7CI95, Q66AY6
2 PIRSF : Q7CI95, Q66AY6
2 SUPERFAM : Q7CI95, Q66AY6
Sequence
Graphical view for this peptide sequence: yerpe-YPO2002
Colored MSA for YcjY-like (raw)
MKHNAFKMTSVFKTTSVFKSTLLAAVISLSSGGAMSADYKLNPFTLTYDG
AITENVKGKVNIHPVTYKLNGLEISANVYTPANYDPAKKYPAVVVAHPNG
GVKEQVAGLYAQRLAEQGYITITADAAYQGASGGLPRNVDKPAYRIEDIH
GMADFITQYPGVDTVRLGLLGICGGGGYSLKAGQTDKRFSAIATLSMFDS
GLVRRNGYQDSQLSTIQERLKQASDARAQEAAGGEVTYVGDAKLTDEQIA
KLPFDLYRQGFEYYGKTHAHPNSTFRYTASSLLDLMRFDAASNMDLIDKP
LLMMAGSKADSLYMSETAFKGASNAKDKELFLIDGATHIETYWQPEYVNQ
AIGKLAQFYGKNL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKHNAFKMTSVFKTTSVFKSTLLAAVISLSSGGAMSADYKLNPFTLTYDG
AITENVKGKVNIHPVTYKLNGLEISANVYTPANYDPAKKYPAVVVAHPNG
GVKEQVAGLYAQRLAEQGYITITADAAYQGASGGLPRNVDKPAYRIEDIH
GMADFITQYPGVDTVRLGLLGICGGGGYSLKAGQTDKRFSAIATLSMFDS
GLVRRNGYQDSQLSTIQERLKQASDARAQEAAGGEVTYVGDAKLTDEQIA
KLPFDLYRQGFEYYGKTHAHPNSTFRYTASSLLDLMRFDAASNMDLIDKP
LLMMAGSKADSLYMSETAFKGASNAKDKELFLIDGATHIETYWQPEYVNQ
AIGKLAQFYGKNL


References
1 more
    Title: Insights into the evolution of Yersinia pestis through whole-genome comparison with Yersinia pseudotuberculosis
    Chain PS, Carniel E, Larimer FW, Lamerdin J, Stoutland PO, Regala WM, Georgescu AM, Vergez LM, Land ML and Garcia E <13 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:13826, 2004 : PubMed

            

    Title: Genome sequence of Yersinia pestis KIM
    Deng W, Burland V, Plunkett G, 3rd, Boutin A, Mayhew GF, Liss P, Perna NT, Rose DJ, Mau B and Perry RD <11 more author(s)>
    Ref: Journal of Bacteriology, 184:4601, 2002 : PubMed

            

    Title: Genome sequence of Yersinia pestis, the causative agent of plague.
    Parkhill J, Wren BW, Thomson NR, Titball RW, Holden MTG, Prentice MB, Sebaihia M, James KD, Churcher C and Barrell BG <25 more author(s)>
    Ref: Nature, 413:523, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer