cers8-m2qf37

Ceriporiopsis subvermispora (strain B) (White-rot fungus) Uncharacterized protein

Comment

Relationship

Family : Fungal_carboxylesterase_lipase

Block : C

Position in NCBI Life Tree : Ceriporiopsis subvermispora

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MATVHLHDELTQSTERVTVQTRFGTIRGGRAANGAAVFLE
VPYALPPGRF LDPVPLPADYQYEEKDYIYESSYAAQPIN
DGQAASVPFEDKVGRGEPTEN PLFVNIVSPPSFPSATGL
PVKVYIHGGFLQFGSPHGLSGQAQYIAAERSE IWVNVGY
RLSAFGFLACDEPRVEGNFGFKDQWLALLWVRDNIEAFGG
NPD NIQISGLSAGAHSVHQLLHYASRLPEGKTAPFNSAV
LQSNSIVIAPKTPA ELRPQFRAFCTALSLNPDGPDALTV
LRDPELVPWKAITHAIETDALGTQF GTFRGSLDGSWLSS
DPESMAWQRSGAFARALRKRGVRSIAVGDLTEEWYL YSI
AHPVRRMRDIELNMERYYQEEVVHAMMALYRRVPDGAPPE
DFARLFG EMLSEGQVHLPVRLLARDLTTAGFPVVRYQIR
WTPEQLRPLGYVTHGSDR SLWALRLPVLKPDQADVARAW
LDSINSALAAAENGEVRGLKEVLALNENQ SIGWRDDDKW
DEIMRLCQALPGEDA

References

Title : Comparative genomics of Ceriporiopsis subvermispora and Phanerochaete chrysosporium provide insight into selective ligninolysis - Fernandez-Fueyo_2012_Proc.Natl.Acad.Sci.U.S.A_109_5458
Author(s) : Fernandez-Fueyo E , Ruiz-Duenas FJ , Ferreira P , Floudas D , Hibbett DS , Canessa P , Larrondo LF , James TY , Seelenfreund D , Lobos S , Polanco R , Tello M , Honda Y , Watanabe T , Ryu JS , Kubicek CP , Schmoll M , Gaskell J , Hammel KE , St John FJ , Vanden Wymelenberg A , Sabat G , Splinter BonDurant S , Syed K , Yadav JS , Doddapaneni H , Subramanian V , Lavin JL , Oguiza JA , Perez G , Pisabarro AG , Ramirez L , Santoyo F , Master E , Coutinho PM , Henrissat B , Lombard V , Magnuson JK , Kues U , Hori C , Igarashi K , Samejima M , Held BW , Barry KW , LaButti KM , Lapidus A , Lindquist EA , Lucas SM , Riley R , Salamov AA , Hoffmeister D , Schwenk D , Hadar Y , Yarden O , de Vries RP , Wiebenga A , Stenlid J , Eastwood D , Grigoriev IV , Berka RM , Blanchette RA , Kersten P , Martinez AT , Vicuna R , Cullen D
Ref : Proc Natl Acad Sci U S A , 109 :5458 , 2012
Abstract : Fernandez-Fueyo_2012_Proc.Natl.Acad.Sci.U.S.A_109_5458
ESTHER : Fernandez-Fueyo_2012_Proc.Natl.Acad.Sci.U.S.A_109_5458
PubMedSearch : Fernandez-Fueyo_2012_Proc.Natl.Acad.Sci.U.S.A_109_5458
PubMedID: 22434909
Gene_locus related to this paper: cers8-m2r3x2 , cers8-m2qf37 , cers8-m2pcy7 , cers8-m2pcz3 , cers8-m2qn26 , cers8-m2r654 , cers8-m2r8g9 , cers8-m2ps90 , cers8-m2qn44 , cers8-m2q837 , cers8-m2pjy6 , cers8-m2r609 , cers8-m2qy35 , cers8-m2r1n1 , cers8-m2rl22 , cers8-m2qkx5 , cers8-m2qib7 , cers8-m2rgs8 , cers8-m2rlx6 , cers8-m2r4p3 , cers8-m2rf62 , cers8-m2qyx5 , cers8-m2pcz2 , cers8-m2rm22 , cers8-m2qwb7 , cers8-m2r9u3 , cers8-m2pp23 , cers8-m2r613 , cers8-m2rup8 , cers8-m2piv7 , cers8-m2rch3 , cers8-m2qvf7 , cers8-m2qvb7 , cers8-m2qvb2 , cers8-m2pip7 , cers8-m2rb73 , cers8-m2qgd3 , cers8-m2rcg8 , cers8-m2rb68