schpo-be46

Schizosaccharomyces pombe (Fission yeast) protein bem46

Comment

Relationship

Family : ABHD13-BEM46

Block : X

Position in NCBI Life Tree : Schizosaccharomyces pombe

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAGSLSSAIFNVLKYSGMASLAVTLIALGFLYKYQKTLVY
PSAFPQGSRE NVPTPKEFNMEYERIELRTRDKVTLDSYL
MLQSESPESRPTLLYFHANAG NMGHRLPIARVFYSALNM
NVFIISYRGYGKSTGSPSEAGLKIDSQTALEY LMEHPIC
SKTKIVVYGQSIGGAVAIALTAKNQDRISALILENTFTSI
KDM IPTVFPYGGSIISRFCTEIWSSQDEIRKIKKLPVLF
LSGEKDEIVPPPQM VLLFGLCGSAKKKFHSFPKCTHNDT
CLGDGYFQVIADFLAENDINTPAS

References

Title : The genome sequence of Schizosaccharomyces pombe - Wood_2002_Nature_415_871
Author(s) : Wood V , Gwilliam R , Rajandream MA , Lyne M , Lyne R , Stewart A , Sgouros J , Peat N , Hayles J , Baker S , Basham D , Bowman S , Brooks K , Brown D , Brown S , Chillingworth T , Churcher C , Collins M , Connor R , Cronin A , Davis P , Feltwell T , Fraser A , Gentles S , Goble A , Hamlin N , Harris D , Hidalgo J , Hodgson G , Holroyd S , Hornsby T , Howarth S , Huckle EJ , Hunt S , Jagels K , James K , Jones L , Jones M , Leather S , McDonald S , McLean J , Mooney P , Moule S , Mungall K , Murphy L , Niblett D , Odell C , Oliver K , O'Neil S , Pearson D , Quail MA , Rabbinowitsch E , Rutherford K , Rutter S , Saunders D , Seeger K , Sharp S , Skelton J , Simmonds M , Squares R , Squares S , Stevens K , Taylor K , Taylor RG , Tivey A , Walsh S , Warren T , Whitehead S , Woodward J , Volckaert G , Aert R , Robben J , Grymonprez B , Weltjens I , Vanstreels E , Rieger M , Schafer M , Muller-Auer S , Gabel C , Fuchs M , Dusterhoft A , Fritzc C , Holzer E , Moestl D , Hilbert H , Borzym K , Langer I , Beck A , Lehrach H , Reinhardt R , Pohl TM , Eger P , Zimmermann W , Wedler H , Wambutt R , Purnelle B , Goffeau A , Cadieu E , Dreano S , Gloux S , Lelaure V , Mottier S , Galibert F , Aves SJ , Xiang Z , Hunt C , Moore K , Hurst SM , Lucas M , Rochet M , Gaillardin C , Tallada VA , Garzon A , Thode G , Daga RR , Cruzado L , Jimenez J , Sanchez M , del Rey F , Benito J , Dominguez A , Revuelta JL , Moreno S , Armstrong J , Forsburg SL , Cerutti L , Lowe T , McCombie WR , Paulsen I , Potashkin J , Shpakovski GV , Ussery D , Barrell BG , Nurse P
Ref : Nature , 415 :871 , 2002
Abstract : Wood_2002_Nature_415_871
ESTHER : Wood_2002_Nature_415_871
PubMedSearch : Wood_2002_Nature_415_871
PubMedID: 11859360
Gene_locus related to this paper: schpo-APTH1 , schpo-be46 , schpo-BST1 , schpo-C2E11.08 , schpo-C14C4.15C , schpo-C22H12.03 , schpo-C23C4.16C , schpo-C57A10.08C , schpo-dyr , schpo-este1 , schpo-KEX1 , schpo-PCY1 , schpo-pdat , schpo-PLG7 , schpo-ppme1 , schpo-q9c0y8 , schpo-SPAC4A8.06C , schpo-C22A12.06C , schpo-SPAC977.15 , schpo-SPAPB1A11.02 , schpo-SPBC14C8.15 , schpo-SPBC530.12C , schpo-SPBC1711.12 , schpo-SPBPB2B2.02 , schpo-SPCC5E4.05C , schpo-SPCC417.12 , schpo-SPCC1672.09 , schpo-yb4e , schpo-yblh , schpo-ydw6 , schpo-ye7a , schpo-ye63 , schpo-ye88 , schpo-yeld , schpo-yk68 , schpo-clr3 , schpo-ykv6

Title : A 38 kb segment containing the cdc2 gene from the left arm of fission yeast chromosome II: sequence analysis and characterization of the genomic DNA and cDNAs encoded on the segment - Machida_2000_Yeast_16_71
Author(s) : Machida M , Yamazaki S , Kunihiro S , Tanaka T , Kushida N , Jinnno K , Haikawa Y , Yamazaki J , Yamamoto S , Sekine M , Oguchi A , Nagai Y , Sakai M , Aoki K , Ogura K , Kudoh Y , Kikuchi H , Zhang MQ , Yanagida M
Ref : Yeast , 16 :71 , 2000
Abstract : Machida_2000_Yeast_16_71
ESTHER : Machida_2000_Yeast_16_71
PubMedSearch : Machida_2000_Yeast_16_71
PubMedID: 10620777
Gene_locus related to this paper: schpo-be46