schpo-SPBC14C8.15

Schizosaccharomyces pombe (Fission yeast) hypothetical 52.7 kda protein

Comment

"Schizosaccharomyces pombe (strain 972 \/ ATCC 24843) (Fission yeast)"

Relationship

Family : Acidic_Lipase

Block : X

Position in NCBI Life Tree : Schizosaccharomyces pombe

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTLNGNIMKYCLEKGEILISFLLIALESMFRICTVILPSP
LRNWFYEQSK KVYSYFLPELLVDDNANKLTDARDTIDLC
ALHGYDLEEHFVRTTDGYLLG LHRVYKKKKGKIEELNYL
PPVLFIHGLMMNSESWVCNLKKEDAIPFALVE QGYDVWL
GNLRGNKYSIKNIKFSSQNPKFWDFSLDSIAIFDIPSIVK
YIL SVNSFDSISLVGFSQGAILAFAALSIDTELRNSVRA
FIALAPAIAPKKYS GRTVKSIIHANSQLLYLMFGRNSML
GSAVFWQAVLYPPVFAKIVDLFLRF FLSWTGKNISETQK
IVAYSHLYSFTSVKCFVHWAQITRRKVLQMYDDSPG FKP
SYYTNLNRIARYPIENIRLPITLVYGSNDNMVDIETLKTQ
LPPLSQC IQIPNYEHLDIIMGDTKKDIVIQQVVEQLNHV
IAGDYFESIKEEFGLDTE LVDGVMNHTI

References

Title : ORFeome cloning and global analysis of protein localization in the fission yeast Schizosaccharomyces pombe - Matsuyama_2006_Nat.Biotechnol_24_841
Author(s) : Matsuyama A , Arai R , Yashiroda Y , Shirai A , Kamata A , Sekido S , Kobayashi Y , Hashimoto A , Hamamoto M , Hiraoka Y , Horinouchi S , Yoshida M
Ref : Nat Biotechnol , 24 :841 , 2006
Abstract : Matsuyama_2006_Nat.Biotechnol_24_841
ESTHER : Matsuyama_2006_Nat.Biotechnol_24_841
PubMedSearch : Matsuyama_2006_Nat.Biotechnol_24_841
PubMedID: 16823372
Gene_locus related to this paper: schpo-APTH1 , schpo-KEX1 , schpo-PLG7 , schpo-SPAC4A8.06C , schpo-SPBC14C8.15 , schpo-SPBPB2B2.02 , schpo-SPCC5E4.05C , schpo-SPCC417.12 , schpo-yeld , schpo-yk68 , schpo-clr3

Title : The genome sequence of Schizosaccharomyces pombe - Wood_2002_Nature_415_871
Author(s) : Wood V , Gwilliam R , Rajandream MA , Lyne M , Lyne R , Stewart A , Sgouros J , Peat N , Hayles J , Baker S , Basham D , Bowman S , Brooks K , Brown D , Brown S , Chillingworth T , Churcher C , Collins M , Connor R , Cronin A , Davis P , Feltwell T , Fraser A , Gentles S , Goble A , Hamlin N , Harris D , Hidalgo J , Hodgson G , Holroyd S , Hornsby T , Howarth S , Huckle EJ , Hunt S , Jagels K , James K , Jones L , Jones M , Leather S , McDonald S , McLean J , Mooney P , Moule S , Mungall K , Murphy L , Niblett D , Odell C , Oliver K , O'Neil S , Pearson D , Quail MA , Rabbinowitsch E , Rutherford K , Rutter S , Saunders D , Seeger K , Sharp S , Skelton J , Simmonds M , Squares R , Squares S , Stevens K , Taylor K , Taylor RG , Tivey A , Walsh S , Warren T , Whitehead S , Woodward J , Volckaert G , Aert R , Robben J , Grymonprez B , Weltjens I , Vanstreels E , Rieger M , Schafer M , Muller-Auer S , Gabel C , Fuchs M , Dusterhoft A , Fritzc C , Holzer E , Moestl D , Hilbert H , Borzym K , Langer I , Beck A , Lehrach H , Reinhardt R , Pohl TM , Eger P , Zimmermann W , Wedler H , Wambutt R , Purnelle B , Goffeau A , Cadieu E , Dreano S , Gloux S , Lelaure V , Mottier S , Galibert F , Aves SJ , Xiang Z , Hunt C , Moore K , Hurst SM , Lucas M , Rochet M , Gaillardin C , Tallada VA , Garzon A , Thode G , Daga RR , Cruzado L , Jimenez J , Sanchez M , del Rey F , Benito J , Dominguez A , Revuelta JL , Moreno S , Armstrong J , Forsburg SL , Cerutti L , Lowe T , McCombie WR , Paulsen I , Potashkin J , Shpakovski GV , Ussery D , Barrell BG , Nurse P
Ref : Nature , 415 :871 , 2002
Abstract : Wood_2002_Nature_415_871
ESTHER : Wood_2002_Nature_415_871
PubMedSearch : Wood_2002_Nature_415_871
PubMedID: 11859360
Gene_locus related to this paper: schpo-APTH1 , schpo-be46 , schpo-BST1 , schpo-C2E11.08 , schpo-C14C4.15C , schpo-C22H12.03 , schpo-C23C4.16C , schpo-C57A10.08C , schpo-dyr , schpo-este1 , schpo-KEX1 , schpo-PCY1 , schpo-pdat , schpo-PLG7 , schpo-ppme1 , schpo-q9c0y8 , schpo-SPAC4A8.06C , schpo-C22A12.06C , schpo-SPAC977.15 , schpo-SPAPB1A11.02 , schpo-SPBC14C8.15 , schpo-SPBC530.12C , schpo-SPBC1711.12 , schpo-SPBPB2B2.02 , schpo-SPCC5E4.05C , schpo-SPCC417.12 , schpo-SPCC1672.09 , schpo-yb4e , schpo-yblh , schpo-ydw6 , schpo-ye7a , schpo-ye63 , schpo-ye88 , schpo-yeld , schpo-yk68 , schpo-clr3 , schpo-ykv6