9actn-h6wx58

 
Thermobifida halotolerans Serine hydrolase Thh_Est polyester hydrolase

Comment
Thermobifida halotolerans DSM44931


Relationship
Block L
Thermobifida halotolerans position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptosporangiales: N E > Nocardiopsaceae: N E > Thermobifida: N E > Thermobifida halotolerans: N E

Molecular evidence
Database
No mutation
No structure
No kinetic

Substrate: Polyethylene-terephthalate ,

1 Genbank : AFA45122
1 UniProt : H6WX58
1 UniProtTrembl : H6WX58
1 Interpro : H6WX58
1 Prodom : H6WX58
1 Pfam : H6WX58
1 PIRSF : H6WX58
1 SUPERFAM : H6WX58
1 QuickSwissBlast : H6WX58
 
Sequence
Graphical view for this peptide sequence: 9actn-h6wx58
Colored MSA for Polyesterase-lipase-cutinase (raw)
MANPYERGPNPTNSSIEALRGPFRVDEERVSRLQARGFGGGTIYYPTDNN
TFGAVAISPGYTGTQSSISWLGERLASHGFVVMTIDTNTTLDQPDSRASQ
LDAALDYMVEDSSYSVRNRIDSSRLAAMGHSMGGGGTLRLAERRPDLQAA
IPLTPWHTDKTWGSVRVPTLIIGAENDTIASVRSHSEPFYNSLPGSLDKA
YLELDGASHFAPNLSNTTIAKYSISWLKRFVDDDTRYTQFLCPGPSTGWG
SDVEEYRSTCPF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MANPYERGPNPTNSSIEALRGPFRVDEERVSRLQARGFGGGTIYYPTDNN
TFGAVAISPGYTGTQSSISWLGERLASHGFVVMTIDTNTTLDQPDSRASQ
LDAALDYMVEDSSYSVRNRIDSSRLAAMGHSMGGGGTLRLAERRPDLQAA
IPLTPWHTDKTWGSVRVPTLIIGAENDTIASVRSHSEPFYNSLPGSLDKA
YLELDGASHFAPNLSNTTIAKYSISWLKRFVDDDTRYTQFLCPGPSTGWG
SDVEEYRSTCPF

no DNA




References
    Title: Perspectives on the Role of Enzymatic Biocatalysis for the Degradation of Plastic PET
    Magalhaes RP, Cunha JM, Sousa SF
    Ref: Int J Mol Sci, 22:11257, 2021 : PubMed

            

    Title: New insights into the function and global distribution of polyethylene terephthalate (PET) degrading bacteria and enzymes in marine and terrestrial metagenomes
    Danso D, Schmeisser C, Chow J, Zimmermann W, Wei R, Leggewie C, Li X, Hazen T, Streit WR
    Ref: Applied Environmental Microbiology, 84:e2773, 2018 : PubMed

            

    Title: A New Esterase from Thermobifida halotolerans Hydrolyses Polyethylene Terephthalate (PET) and Polylactic Acid (PLA)
    Ribitsch D, Herrero Acero E, Greimel K, Dellacher A, Zitzenbacher S, Marold A, Rodriguez RD, Steinkellner G, Gruber K and Guebitz GM <1 more author(s)>
    Ref: Polymers, 4:617, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer