Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: altma-s5cfn7

Alteromonas macleodii EH119 Esterase

Comment
Other strains: Alteromonas macleodii (Strains: Ionian Sea (UM4b; UM7; U8; U7; U4); English Channel 615; Aegean Sea MED64); AltDE1; DSM 17117 / Deep ecotype) EH119 promiscuous activity 6/96 substrates Martinez-Martinez et al. 2018


Relationship
Family|GTSAGmotif
Block| H
Position in NCBI Life Tree|Alteromonas macleodii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Alteromonadales: N E > Alteromonadaceae: N E > Alteromonas: N E > Alteromonas macleodii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 7 more: KR107280, CP004855, CP004853
>3 UniProt links 1 more: A0A1S5QL22, S5C2U4, F2G667
3 UniProt : S5C2U4, F2G667, S5AK24
3 Interpro : S5C2U4, F2G667, S5AK24
3 Prodom : S5C2U4, F2G667, S5AK24
3 Pfam : S5C2U4, F2G667, S5AK24
3 PIRSF : S5C2U4, F2G667, S5AK24
3 SUPERFAM : S5C2U4, F2G667, S5AK24
Sequence
Graphical view for this peptide sequence: altma-s5cfn7
Colored MSA for GTSAGmotif (raw)
MKYIHMLMYVLTFSFAPITLATTDPMHDNKPPLPQAASEALINSISAFSH
FTKEEVKASTPGTNEAWRNYVHARNSEQKKKIKKMKKALNVDIELMNLND
VVVRKLTPKAITPEFKDKVYLDIHGGAFVLFGGLPSIEEGLLVAERLGIV
VYSVDYRMPPTFPFPAALNDVVAVYNALLDQAGEGNIFVGGTSAGGGLVL
SLVQSLIKSETPLPNAVYAGTPWADLTKTSDSLYTNEGIDNVLVTYDGQL
EAAAKLYAGKKALTDPAISPLYGSFGHFPPTFLVTGTRDLFLSDTVRVNR
AIRDSKGVTQLEVFEGLSHAEYLIFYKTPESETTYHLMKSFFLSYL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKYIHMLMYVLTFSFAPITLATTDPMHDNKPPLPQAASEALINSISAFSH
FTKEEVKASTPGTNEAWRNYVHARNSEQKKKIKKMKKALNVDIELMNLND
VVVRKLTPKAITPEFKDKVYLDIHGGAFVLFGGLPSIEEGLLVAERLGIV
VYSVDYRMPPTFPFPAALNDVVAVYNALLDQAGEGNIFVGGTSAGGGLVL
SLVQSLIKSETPLPNAVYAGTPWADLTKTSDSLYTNEGIDNVLVTYDGQL
EAAAKLYAGKKALTDPAISPLYGSFGHFPPTFLVTGTRDLFLSDTVRVNR
AIRDSKGVTQLEVFEGLSHAEYLIFYKTPESETTYHLMKSFFLSYL


References
    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            

    Title: Genomic diversity of deep ecotype Alteromonas macleodii isolates: evidence for Pan-Mediterranean clonal frames
    Lopez-Perez M, Gonzaga A, Rodriguez-Valera F
    Ref: Genome Biol Evol, 5:1220, 2013 : PubMed

            

    Title: Comparative genomics of two ecotypes of the marine planktonic copiotroph Alteromonas macleodii suggests alternative lifestyles associated with different kinds of particulate organic matter
    Ivars-Martinez E, Martin-Cuadrado AB, D'Auria G, Mira A, Ferriera S, Johnson J, Friedman R, Rodriguez-Valera F
    Ref: Isme J, 2:1194, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer