arath-At2g15230

 
Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) F15A23.3 triacylglycerol lipase 1 precursor (EC 3.1.1.3)

Comment
Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)


Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 3 more: AC006298, AC007071, AF530477
3 UniProt : Q71DJ5, Q1H5B7, D7L3J6
1 Ncbi-nid : 6598553
1 Ncbi-pid : 4585908
3 UniProtTrembl : Q71DJ5, Q1H5B7, D7L3J6
3 Interpro : Q71DJ5, Q1H5B7, D7L3J6
3 Prodom : Q71DJ5, Q1H5B7, D7L3J6
3 Pfam : Q71DJ5, Q1H5B7, D7L3J6
3 PIRSF : Q71DJ5, Q1H5B7, D7L3J6
3 SUPERFAM : Q71DJ5, Q1H5B7, D7L3J6
3 QuickSwissBlast : Q71DJ5, Q1H5B7, D7L3J6
1 Tair database : AT2G31690
 
Sequence
Graphical view for this peptide sequence: arath-At2g15230
Colored MSA for Acidic_Lipase (raw)
MKWLLVAVLTSLTIFSALTQSHLLHGSPVNSLCADLIHPANYSCTEHSIQ
TKDGYILALQRVASLGPRLQSGPPVLLQHGLFMAGDVWFLNSPKESLGFI
LADHGFDVWVGNVRGTRYSYGHVTLSDTDKEFWDWSWQDLAMYDLAEMIQ
YLYSISNSKIFLVGHSQGTIMSFAALTQPHVAEMVEAAALLCPISYLDHV
TAPLVERMVFMHLDQMVVALGLHQINFRSDMLVKLVDSLCEGHMDCTDFL
TSITGTNCCFNASKIEYYLDYEPHPSSVKNIRHLFQMIRKGTFAQYDYGY
FKNLRTYGLSKPPEFILSHIPASLPMWMGYGGTDGLADVTDVEHTLAELP
SSPELLYLEDYGHIDFVLGSSAKEDVYKHMIQFFRAKVKSSSW
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKWLLVAVLTSLTIFSALTQSHLLHGSPVNSLCADLIHPANYSCTEHSIQ
TKDGYILALQRVASLGPRLQSGPPVLLQHGLFMAGDVWFLNSPKESLGFI
LADHGFDVWVGNVRGTRYSYGHVTLSDTDKEFWDWSWQDLAMYDLAEMIQ
YLYSISNSKIFLVGHSQGTIMSFAALTQPHVAEMVEAAALLCPISYLDHV
TAPLVERMVFMHLDQMVVALGLHQINFRSDMLVKLVDSLCEGHMDCTDFL
TSITGTNCCFNASKIEYYLDYEPHPSSVKNIRHLFQMIRKGTFAQYDYGY
FKNLRTYGLSKPPEFILSHIPASLPMWMGYGGTDGLADVTDVEHTLAELP
SSPELLYLEDYGHIDFVLGSSAKEDVYKHMIQFFRAKVKSSSW

Graphical view for this nucleotide DNA sequence (2607 bp): arath-At2g15230



References
1 more
    Title: Characterization of a plastid triacylglycerol lipase from Arabidopsis
    Padham AK, Hopkins MT, Wang TW, McNamara LM, Lo M, Richardson LG, Smith MD, Taylor CA, Thompson JE
    Ref: Plant Physiol, 143:1372, 2007 : PubMed

            

    Title: Identification and characterization of a triacylglycerol lipase in Arabidopsis homologous to mammalian acid lipases
    El-Kouhen K, Blangy S, Ortiz E, Gardies AM, Ferte N, Arondel V
    Ref: FEBS Letters, 579:6067, 2005 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer