arath-At2g45610

 
Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) AtCXE9 At2g45610 F17K2.14, chromosome II

Relationship
Block H
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : AC003680, AE002093
2 UniProt : D7LCL0, O64641
1 Ncbi-nid : 6598396
1 Ncbi-pid : 2979556
2 UniProtTrembl : O64641, D7LCL0
2 Interpro : O64641, D7LCL0
2 Prodom : O64641, D7LCL0
2 Pfam : O64641, D7LCL0
2 PIRSF : O64641, D7LCL0
2 SUPERFAM : O64641, D7LCL0
2 QuickSwissBlast : O64641, D7LCL0
1 Tair database : At2g45610
 
Sequence
Graphical view for this peptide sequence: arath-At2g45610
Colored MSA for Plant_carboxylesterase (raw)
MSRDSPPAFDPYKHLNITINPNGSCTRHFVWPRVEPDPDPCPGKLAASKD
VTINHETGVSVRIFRPTNLPSNDNAVARLPIIIHLHGSGWILYPANSAAN
DRCCSQMASELTVIVVSVHYRLPPEHRLPAQYDDALDALLWVKQQVVDST
NGEPWLKDYADFSRCYICGSSNGANIAFQLALRSLDHDLTPLQIDGCVFY
QPLFGGKTRTKSELKNFADPVMPVPAVDAMWELSLPVGVDRDHRYCNPLG
YLPQKEKVGRLGRCLVIGYGGDTSLDRQQDFVNLLVAAGVRVEARFDDAG
FHSIELVDPRRAVALLNMIRDFIS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSRDSPPAFDPYKHLNITINPNGSCTRHFVWPRVEPDPDPCPGKLAASKD
VTINHETGVSVRIFRPTNLPSNDNAVARLPIIIHLHGSGWILYPANSAAN
DRCCSQMASELTVIVVSVHYRLPPEHRLPAQYDDALDALLWVKQQVVDST
NGEPWLKDYADFSRCYICGSSNGANIAFQLALRSLDHDLTPLQIDGCVFY
QPLFGGKTRTKSELKNFADPVMPVPAVDAMWELSLPVGVDRDHRYCNPLG
YLPQKEKVGRLGRCLVIGYGGDTSLDRQQDFVNLLVAAGVRVEARFDDAG
FHSIELVDPRRAVALLNMIRDFIS

Graphical view for this nucleotide DNA sequence (1012 bp): arath-At2g45610



References
1 more
    Title: Molecular characterization of the AtCXE8 gene, which promotes resistance to Botrytis cinerea infection
    Sanghyeob L, Seongbin H, Yong W, Seo W, Bae J
    Ref: Plant Biotechnol Rep, 7:109, 2013 : PubMed

            

    Title: The carboxylesterase gene family from Arabidopsis thaliana
    Marshall SD, Putterill JJ, Plummer KM, Newcomb RD
    Ref: Journal of Molecular Evolution, 57:487, 2003 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer