arath-SFGH

 
Arabidopsis thaliana (Mouse-ear cress) serine esterase s-formylglutathione hydrolase SFGH At2g41530 T32G6.5

Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E

Molecular evidence
Database
No mutation
1 structure:
ZZZZ: Crystal structure of Arabidopsis thaliana serine esterase s-formylglutathione hydrolase
No kinetic



>3 Genbank links 2 more: AC002510, AY087636, AJ347732
1 UniProt : Q8LAS8
1 Structure : ZZZZ
1 UniProtTrembl : Q8LAS8
1 Interpro : Q8LAS8
1 Prodom : Q8LAS8
1 Pfam : Q8LAS8
1 PIRSF : Q8LAS8
1 SUPERFAM : Q8LAS8
1 QuickSwissBlast : Q8LAS8
1 Tair database : At2g41530
 
Sequence
Graphical view for this peptide sequence: arath-SFGH
Colored MSA for A85-EsteraseD-FGH (raw)
MASGLSEIGSTKMFDGYNKRYKHFSETLGCSMTFSIYFPPSASSSHKSPV
LYWLSGLTCTDENFIIKSGAQRAASTHGIALVAPDTSPRGLNVEGEADSY
DFGVGAGFYLNATQEKWKNWRMYDYVVKELPKLLSENFSQLDTTKASISG
HSMGGHGALTIYLRNLDKYKSVSAFAPITNPINCAWGQKAFTNYLGDNKA
AWEEYDATCLISKYNNLSATILIDQGENDQFYPDQLLPSKFEEACKKVNA
PLLLRLHPGYDHSYYFIATFIEDHISHHAQALEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASGLSEIGSTKMFDGYNKRYKHFSETLGCSMTFSIYFPPSASSSHKSPV
LYWLSGLTCTDENFIIKSGAQRAASTHGIALVAPDTSPRGLNVEGEADSY
DFGVGAGFYLNATQEKWKNWRMYDYVVKELPKLLSENFSQLDTTKASISG
HSMGGHGALTIYLRNLDKYKSVSAFAPITNPINCAWGQKAFTNYLGDNKA
AWEEYDATCLISKYNNLSATILIDQGENDQFYPDQLLPSKFEEACKKVNA
PLLLRLHPGYDHSYYFIATFIEDHISHHAQALEL

no DNA




References
3 more
    Title: Unique regulation of the active site of the serine esterase S-formylglutathione hydrolase
    Cummins I, McAuley K, Fordham-Skelton A, Schwoerer R, Steel PG, Davis BG, Edwards R
    Ref: Journal of Molecular Biology, 359:422, 2006 : PubMed

            

    Title: Full-length messenger RNA sequences greatly improve genome annotation
    Haas BJ, Volfovsky N, Town CD, Troukhan M, Alexandrov N, Feldmann KA, Flavell RB, White O, Salzberg SL
    Ref: Genome Biol, 3:RESEARCH0029, 2002 : PubMed

            

    Title: Cloning and characterization of an S-formylglutathione hydrolase from Arabidopsis thaliana
    Kordic S, Cummins I, Edwards R
    Ref: Archives of Biochemistry & Biophysics, 399:232, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer