Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-at5g18630

Arabidopsis thaliana (Mouse-ear cress) at5g18630/t1a4_10

Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : BT015039, AY058096
1 UniProt : Q6DBI3
2 UniProt : Q93Z64, Q6DBI3
2 Interpro : Q93Z64, Q6DBI3
2 Prodom : Q93Z64, Q6DBI3
2 Pfam : Q93Z64, Q6DBI3
2 PIRSF : Q93Z64, Q6DBI3
2 SUPERFAM : Q93Z64, Q6DBI3
1 Tair database : AT5g18630
Sequence
Graphical view for this peptide sequence: arath-at5g18630
Colored MSA for Lipase_3 (raw)
MGQKRLLFLLAVFTFLVSSSYGRVLKLKSDDDRPVYNHTLAVTLVEYASA
VYESDLTKLFTWTCERCNGLTKDFEVIEVIFDVEHCLQAYVGVAKDLNAI
IIAFRGTQEHSIQNWVSDLFWKQLDLNYPDMPDAMVHHGFYSAYHNTTLR
PAVLDAITRVKKVYGANINIIVTGHSMGGAMASFCGLDLVVNEGEENVQV
MTFGQPRVGNAAFASYYSLLVPNTFRITHDRDMVPHLPPYYYHFPQKTYH
HFPTEVWVKDFSFSNFVLFGLEKVCDNTGEDPTCSRSVRGNSISDHLRYF
GVELKCESWRQCSIVMNQDMERYSRKDSRGNLFLSRTVPPKDVVKTSSLS
KTGISSL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGQKRLLFLLAVFTFLVSSSYGRVLKLKSDDDRPVYNHTLAVTLVEYASA
VYESDLTKLFTWTCERCNGLTKDFEVIEVIFDVEHCLQAYVGVAKDLNAI
IIAFRGTQEHSIQNWVSDLFWKQLDLNYPDMPDAMVHHGFYSAYHNTTLR
PAVLDAITRVKKVYGANINIIVTGHSMGGAMASFCGLDLVVNEGEENVQV
MTFGQPRVGNAAFASYYSLLVPNTFRITHDRDMVPHLPPYYYHFPQKTYH
HFPTEVWVKDFSFSNFVLFGLEKVCDNTGEDPTCSRSVRGNSISDHLRYF
GVELKCESWRQCSIVMNQDMERYSRKDSRGNLFLSRTVPPKDVVKTSSLS
KTGISSL


References
    Title: Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana
    Tabata S, Kaneko T, Nakamura Y, Kotani H, Kato T, Asamizu E, Miyajima N, Sasamoto S, Kimura T and Fransz P <119 more author(s)>
    Ref: Nature, 408:823, 2000 : PubMed

            

    Title: Structural analysis of Arabidopsis thaliana chromosome 5. VIII. Sequence features of the regions of 1,081,958 bp covered by seventeen physically assigned P1 and TAC clones.
    Asamizu E, Sato S, Kaneko T, Nakamura Y, Kotani H, Miyajima N, Tabata S
    Ref: DNA Research, 5:379, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer